Discover, Find, Share

For Find Best Images or Videos

We quarantee to you best instagram experience as Mininsta Group. We don't want any login or any informtaions from you.

You can find your ex-partner photos or videos and stalk without being afraid accidentally pushing like or follow buttons :))

More, you can find nearby accounts within 500 meters and you can discover people around you.

Besides, you can find your own instagram photos in this website, you can share with your friends.

Below, you can see all the categorized top instagram accounts as Most Popular, Famous People, Travellers, Funny, Food and Most Active.

Come on in, start to discover, find, share..


Search Tagsfor moscow

⠀⠀⠀⠀⠀⠀      Lady's Fl🍬w™ (ladys_flow) Instagram Photos and Videos

⠀⠀⠀⠀⠀⠀ Lady's Fl🍬w™

@ladys_flow


Comment from ⠀⠀⠀⠀⠀⠀ Lady's Fl🍬w™:


5 Seconds ago
A.A. (misirelli) Instagram Photos and Videos

A.A.

@misirelli


Comment from A.A.:


sneakers sneaker pharrell pharrelwilliams nmd humanrace adidas yeezy yeezyboost hypebeast hype sneakerhead moscow moscowcity msk nobleink earthbody nike air af1 nikeairmax nikeairforce offwhite sneakerporn sneakercommunity

12 Seconds ago
Светлана (zvotka_msq) Instagram Photos and Videos

Светлана

@zvotka_msq


Comment from Светлана:


закат sunset moscow москва

20 Seconds ago
Egoncy Brand Making Agency (egoncy_brand_agency) Instagram Photos and Videos

Egoncy Brand Making Agency

@egoncy_brand_agency


Comment from Egoncy Brand Making Agency:


👑 У вас есть мечта или уникальная идея 👑Вы хотите быть узнаваемым 👑Повышать свою переговорную силу 👑Отличаться от конкурентов 👑Иметь постоянный поток клиентов 👑Устанавливать стоимость ваших услуг выше среднерыночной 👑Снижать расходы на продвижение 👑Заниматься разными бизнесами под своим именем 😎 И, самое главное, – вы хотите быть свободным, но при этом хорошо зарабатывать, выбирая с кем и на каких условиях сотрудничать 😎 Посетите наш сайт - www.egoncy.com 💎 Получите бесплатную консультацию, через бота SANTARI - http://m.me/egoncy Riga latvija vecriga reklama smm brand egoncy brandagency Europe moscow Москва бренд продвижениеинстаграм реклама traffic Рига Латвия маркетинг отдых Анимация от @openmindedhd

24 Seconds ago
Welcome to my puppy profile💁🏽🐕 (akita_bampu) Instagram Photos and Videos

Welcome to my puppy profile💁🏽🐕

@akita_bampu


Comment from Welcome to my puppy profile💁🏽🐕:


♥️♥️♥️ •мойбампу🐕mybampu🐕aki 🐕akita_bampuakitaakitainuakit uakitarussiaakitaruakitamoscow oscowmoscowmoscowcitymoscowdog owdogakitadogakitaclubakitalif talifehappyhappylifehappydogha doghappymomilovedogsdogs_of_in of_instagramdogdogwalkingloved

28 Seconds ago
 (mavka666) Instagram Photos and Videos

mavka666

@mavka666


Comment from mavka666:


Огни большого города💥 happy moscow цдм2018скороновыйгод москва like4like f4f огнибольшогогорода лайккраснаяплощадь

28 Seconds ago
Ekaterina (ruzanova_ekaterina) Instagram Photos and Videos

Ekaterina

@ruzanova_ekaterina


Comment from Ekaterina:


насыщенныйвыходнойденьвечерноч ерночьновыйгодскоро✨✨✨всеуспет успетьвездепобывать girlstrene trenerchoreographymoscowmodela odelactresssportdancestylefitn

34 Seconds ago
тренировка в зале и дома (workout_in_gym_and_home) Instagram Photos and Videos

тренировка в зале и дома

@workout_in_gym_and_home


Comment from тренировка в зале и дома:


Follow👉🏻workout _in_gym_and_home ( @workout_in_gym_and_home)👉🏻for more content _______________________ follo fitness bodybuilding dobyduilder фитнесбелгород белгорозал тренербелгород фитнес фитнесдома тренеровка персональныйтренербелгород инструкторпофитнесу интрукторбелгород здороваяеда пп правильноепитание кардиотренировка кардио cardio protein proteinbar протеин протеинвдомашнихусловияхбелгор москва санктпетербург belgorod moscow sanktpeterburg workout_in_gym_and_home

35 Seconds ago
Tim Basenji (timbasenji) Instagram Photos and Videos

Tim Basenji

@timbasenji


Comment from Tim Basenji:


Июль 2017 (juli 2017), начало путешествия до Москвы. tågstationen hund dog basenji animals Sweden Moscow södermaland angelkongo африканскиймолчун другчеловека кожаныйнос собакакусака собака Москва Швеция рыжий путешествие станция чемоданы басенджиТим

38 Seconds ago
cabin.love_bakubss2 (cabin.love_bak) Instagram Photos and Videos

cabin.love_bakubss2

@cabin.love_bak


Comment from cabin.love_bakubss2:


trump alonehome azerbaijan aztagram solotica socoldout disneylandparis chanel brazilianvirginhair breakfast moroccanoil mydreaamsss🎈 moscow morning lovelycat baku goldenretriever dogstagram camp couplegoals cashfollowplane nature dolcegabbana

38 Seconds ago
BRAVO catering (bravo_catering) Instagram Photos and Videos

BRAVO catering

@bravo_catering


Comment from BRAVO catering:


Упакуем и доставим вам новогоднее настроение! . . . . . celebrat color москва moscow decor decoration праздник eat decorations decoração decoracao celebration праздники оформление оформлениесвадьбы торжество еда оформлениесвадеб celebrationtime перово perovo celebrationoflife оформлениезала beautiful cute followme food catering party happy

49 Seconds ago
drawing, photos ^0^ (tvoi_maffin) Instagram Photos and Videos

drawing, photos ^0^

@tvoi_maffin


Comment from drawing, photos ^0^:


✨✨ ph pho photo photos photographer photooftheday like repost follow wow omg girl cute christmas christmasday perfect lifestyle instastyle memories weekend december instagirl insta pink purple style Москва ГУМ 😍 Moscow

54 Seconds ago
Boutique (_wowyoulook_) Instagram Photos and Videos

Boutique

@_wowyoulook_


Comment from Boutique:


Свитера с днями недели 🔝🔝 . . . diamondsjewelleryri eryringshineejewelryshoppingod ingodessashoppingwomanwomansty anstylewomansecretforufashionf hionfashionstylefashionstylefa ylefashiongirlwomanlookwomanbe manbeautyshoppingdayshoppingis ingislifeukrainiandesignerukra rukrainianbrandkievlvivkharkiv

1 Minutes ago
софия )))) (soffia_life77) Instagram Photos and Videos

софия ))))

@soffia_life77


Comment from софия )))):


Даже в Турции зима ((( а в Москве 🤧moscow winter turkey khair kemer snow

1 Minutes ago
Антон Фрост Москва (mr.antony_frost) Instagram Photos and Videos

Антон Фрост Москва

@mr.antony_frost


Comment from Антон Фрост Москва:


Beautiful Ingrid 😊wowsoulmateinstagoodmotivate ivatedmodelingridmoscowrushsty shstylevscodancergmwinterhappy happynewyearantonfrostmoonlife nlifestylelifestylebloggershow rshowжизнькайфмирзожискусствоа

1 Minutes ago
♡♡♡Elena♡♡♡ (helen_l.l.l.l) Instagram Photos and Videos

♡♡♡Elena♡♡♡

@helen_l.l.l.l


Comment from ♡♡♡Elena♡♡♡:


Перфекто👌 Москва... станция Электрозаводская... Полночь... moscow moscowcity moscowmule moscowdays moscowgirl moscowmoscow moscow_life moscowregion moscowraceway moscowneversleeps moscowriver moscowgirls moscowmetro moscowmules moscowlife instagramanet instatag москва москвасити москварека москваялюблютебя инстаграм_порусски инстаграмнедели инстаграманет инстатаг москве москва2017 московский московская москвасейчас

1 Minutes ago
alyssahill312 (alyssahill312) Instagram Photos and Videos

alyssahill312

@alyssahill312


Comment from alyssahill312:


- 📍 Las Vegas, NV, U.S.A - 📷 Photo by @_missjetlagged_ - ⃣ Use for your chance to be featured. - 👥 Tag people you'd love to come here with! - . . . dog artistic stalker blue gold faves iceland pantai digitalnomad neverstopexploring photographyislife visualart streetwomen trees 80likesthankyou moscow blackandwhitephoto

1 Minutes ago
Иван (supersyakin) Instagram Photos and Videos

Иван

@supersyakin


Comment from Иван:


Присылайте фото своих авто в Директ. ( Send photos of your car in Direct ) 👍санктпетербург москва model moscow mercedes ferrari bmw audi ford авто auto car тюнинг тачки chevrolet 2018 2017 зима россия instaauto automobile autogespot autos nissan mitsubishi toyota subaru lamborghini cadillac bugatti

1 Minutes ago
☆•°Julia Sribnaya°•☆ (vladimirovnau) Instagram Photos and Videos

☆•°Julia Sribnaya°•☆

@vladimirovnau


Comment from ☆•°Julia Sribnaya°•☆:


Девочки.... Мы ещё и Каие Девочки 😎😍 @flower.i.am.the.one Прекрасное завершение недели! 💝 МХАТ театр постановка идиальныймуж 18+ Москва moscow

1 Minutes ago
Жизнь столицы (msk_vita) Instagram Photos and Videos

Жизнь столицы

@msk_vita


Comment from Жизнь столицы:


В Москве появится волшебный лес 🎄🌲🎄 В дни фестиваля "Путешествие в Рождество" Манежная площадь превратится в сказочный лес с извилистыми тропинками. На площади установят более 500 искусственных сосен и елей. Прогулявшись по этому лесу, можно стать свидетелем сцен из спектакля «12 месяцев». Фактически каждый сможет побывать и полноправным участником постановки, так как спектакль будет иммерсивным — с полным погружением зрителя в действие. Примечательно, что декорации спектакля разместят в разных уголках леса: на специальных театральных локациях будут разыгрываться определенные сцены. Чтобы увидеть представление целиком, нужно будет обойти весь сказочный лес. msk msk_vita moscow snow событие москва столицароссии чудесаприроды архитектура красавицамосква МК Новыйгод 2018 новый2018 выставка гдепровестивыходные мск_выходные мероприятие мск фестивальмск

1 Minutes ago
Ledenev_Denis (ledenev_denis) Instagram Photos and Videos

Ledenev_Denis

@ledenev_denis


Comment from Ledenev_Denis:


Новогодние врата❄️✨ vsco vscocam vscomoscow vscorussia moscow street winter

1 Minutes ago
Anton (potapov_blvck) Instagram Photos and Videos

Anton

@potapov_blvck


Comment from Anton:


гум newyear moscow redsquare 1 перед новым годом ГУМ становится просто сказочным)

1 Minutes ago
Maria (mariksa_10) Instagram Photos and Videos

Maria

@mariksa_10


Comment from Maria:


москвавечердекабрькраснаяплоща площадьгумвидпрогулкаархитекту тектурагородсветmoscowinstamos tamoscowrussiaeveningdecemberr mberredsquaregumviewcitycitysc ityscapecitylifewalkingarchite chitecturelightschristmasiscom

1 Minutes ago
Иван (supersyakin) Instagram Photos and Videos

Иван

@supersyakin


Comment from Иван:


Присылайте фото своих авто в Директ. ( Send photos of your car in Direct ) 👍санктпетербург москва model moscow mercedes ferrari bmw audi ford авто auto car тюнинг тачки chevrolet 2018 2017 зима россия instaauto automobile autogespot autos nissan mitsubishi toyota subaru lamborghini cadillac bugatti

1 Minutes ago
Thrupp & Maberly (thruppmaberly) Instagram Photos and Videos

Thrupp & Maberly

@thruppmaberly


Comment from Thrupp & Maberly:


Moscow River by night. moscow river russia view

1 Minutes ago
ЦВЕТЫ БУКЕТЫ ОФОРМЛЕНИЯ (decor_e2r) Instagram Photos and Videos

ЦВЕТЫ БУКЕТЫ ОФОРМЛЕНИЯ

@decor_e2r


Comment from ЦВЕТЫ БУКЕТЫ ОФОРМЛЕНИЯ:


Две недели до Нового Года! Вы готовы? . . . . . e2r е2р celebration color москва moscow decor decoration праздник букет decorations decoração decoracao celebration праздники оформление оформлениесвадьбы торжество flowers оформлениесвадеб букетневесты celebrationoflife оформлениезала beautiful cute followme цветы party happy wedding

1 Minutes ago
Alexey Rasskazov (rasskazov.alexey) Instagram Photos and Videos

Alexey Rasskazov

@rasskazov.alexey


Comment from Alexey Rasskazov:


бокс мма сартана востокспорт украина россия москва boxing mma vostoksport sartana mariupol moscow ukraine europe

2 Minutes ago
orangenadya (orangenadya) Instagram Photos and Videos

orangenadya

@orangenadya


Comment from orangenadya:


🎄💫 ItalystylebonitoItaliaItalybon lybonitaкрасотаnewyorklondonch donchicagoparismoscowtokyomadr omadridberlinargentinaarchitec hitecturearquitecturadesigndre gndreamamazingfollowmeprettyna ttynaturefriendsartlike4likevs

2 Minutes ago
 (coolest_chef) Instagram Photos and Videos

coolest_chef

@coolest_chef


Comment from coolest_chef:


Мусс ягоды и нотка любви 👌👌 Photo by: @djioi osetia moscow братислава novoemesto coolest_chef груша карамель ваниль chef chefsroll chefstalk chefslife chefchaouen chefspecial cool foodporn foodphoto foodstagram food 🤙👌💪шоколад ягоды клубника нобиль

2 Minutes ago
Gerda Mori(Зеленоград) (morigerda) Instagram Photos and Videos

Gerda Mori(Зеленоград)

@morigerda


Comment from Gerda Mori(Зеленоград):


Little blue kitty .sold

2 Minutes ago
 (alinbosik) Instagram Photos and Videos

alinbosik

@alinbosik


Comment from alinbosik:


Buona notte 💜 . . . buonanotte instagood instamood instame selfie moscow italy italia partytime party instagram instanight goodnight moon lips eyes red lipstick love lovestory about me gold dress

3 Minutes ago
EMIN Official FC In Europe (officialclubemineurope) Instagram Photos and Videos

EMIN Official FC In Europe

@officialclubemineurope


Comment from EMIN Official FC In Europe:


Baku ✊🏻✊🏻👏🏻👏🏻👏🏻 @eminofficial 💥💥💥🙌🏻✌🏻eminbaku Repost from @beatgroupeuropeuklondongermanyberlin franceparisitalyswitzerlandams ndamsterdammoscowaustriadenmar enmarkirelanddublinfinlandpola dpolandwarshawagreecespainibiz nibizaswedenisraelaustraliaant

3 Hours ago
EMIN Official FC In Europe (officialclubemineurope) Instagram Photos and Videos

EMIN Official FC In Europe

@officialclubemineurope


Comment from EMIN Official FC In Europe:


Tonight @eminofficial live in Baku at Heydar Aliyev Center 💥🙌🏻✌🏻emin baku Repost from @beatgroupeuropeuklondongermanyberlin franceparisitalyswitzerlandams ndamsterdammoscowaustriadenmar enmarkirelanddublinfinlandpola dpolandwarshawagreecespainibiz nibizaswedenisraelaustraliaant

3 Hours ago