Discover, Find, Share

For Find Best Images or Videos

We quarantee to you best instagram experience as Mininsta Group. We don't want any login or any informtaions from you.

You can find your ex-partner photos or videos and stalk without being afraid accidentally pushing like or follow buttons :))

More, you can find nearby accounts within 500 meters and you can discover people around you.

Besides, you can find your own instagram photos in this website, you can share with your friends.

Below, you can see all the categorized top instagram accounts as Most Popular, Famous People, Travellers, Funny, Food and Most Active.

Come on in, start to discover, find, share..


Search Tagsfor picoftheday

Lucas Melo (melolucas_02) Instagram Photos and Videos

Lucas Melo

@melolucas_02


Comment from Lucas Melo:


Quando se soma, divide e multiplica. 🖤👯‍♂️🖤 love picoftheday saopaulo gostosura liberdade amor

3 Seconds ago
Arianna Lapenna (ariannaalapenna) Instagram Photos and Videos

Arianna Lapenna

@ariannaalapenna


Comment from Arianna Lapenna:


A year ago we stayed up till 3 a.m talking and today we don't know how to say "hey" smilingalways ig_italia igaddict igeroftheday igworldclub ig_captures photos pics landscape travel photo travelgram pictureoftheday photooftheday picoftheday igers igersmilano igersitalia igdaily igpic igphoto igtravel photogrid photogram photographer photography photografie streetphotography instagrames god

3 Seconds ago
Haley (highimhaley1) Instagram Photos and Videos

Haley

@highimhaley1


Comment from Haley:


Single, hoes 🤘🏼😈 love lesbian dimple instagood me smile follow cute photooftheday colorful blackandwhite followme girl beautiful happy picoftheday instadaily swag amazing fashion igers fun summer instalike bestoftheday hot like4like friends instamood likeforlike

3 Seconds ago
Valilù (valilu) Instagram Photos and Videos

Valilù

@valilu


Comment from Valilù:


"...come take me home again..." love instagood photooftheday @top.tags photoeveryday cute picture beautiful followme happy follow fashion pic picoftheday like4like tags 200likes instadaily friends instagrammers fun smile igers instalike likeforlike 20likes 10likes pretty instamood follow4follow photography

4 Seconds ago
COMPODALA (compodala) Instagram Photos and Videos

COMPODALA

@compodala


Comment from COMPODALA:


House Schminke, completed in 1933, designed by Hans Scharoun architecture home residential family familyhome neuesbauen internationalstyle instadaily beautiful amazing wonderful_places awesome nice great me followme photography picoftheday photooftheday instaarchitecture germany saxony löbau scharoun hansscharoun schminke houseschminke hausschminke compodala beltroy

4 Seconds ago
Rita Rusciano (rita_rusciano) Instagram Photos and Videos

Rita Rusciano

@rita_rusciano


Comment from Rita Rusciano:


I like to stand up, turning dreams into actions and take what I want! I can't be different, I am me. dream plan execute bewhoyouare dowhatyoulove ----- love instadaily tagsforlikes instagood me instagramhub tbt follow cute iphoneonly photooftheday igdaily instamood bestoftheday iphonesia picoftheday igers girl tweegram beautiful

4 Seconds ago
El Putisimo Amo 👽 (soyelpapu) Instagram Photos and Videos

El Putisimo Amo 👽

@soyelpapu


Comment from El Putisimo Amo 👽:


👽 🗣Like🖒y Siguenos👥 Para mas Contenido📰👇 🔴 @Soyelpapu 🔵S 🔴 @Soyelpapu 🔵I 🔴 @Soyelpapu 🔵G 🔴 @Soyelpapu 🔵U 🔴 @Soyelpapu 🔵E 🔴 @Soyelpapu 🔵M 🔴 @Soyelpapu 🔵E Activa notificaciones para ver contenido al instante.📲 comedia, instagood,argentina, españa, tbt, cute, happy, lol , followme, chilefollow, venezuela, colombia, BARRANQUILLA, picoftheday, summer, friends, instadaily, siguemeytesigo, fun, repost, smile, follow4follow , tagsforlikes, instalike, meme, family, risa ,memes

4 Seconds ago
Richardo controle (richojkl) Instagram Photos and Videos

Richardo controle

@richojkl


Comment from Richardo controle:


¡Solo aquí tenemos las mejores fotos! -> @revaofficial <- tweegram smile style fit look colorful food instadaily girl like4like follow follow4follow girls instagood picoftheday photooftheday iphoneonly amazing TagsForLikesApp TagsForLikes followme love swag all_shots instago instafollow bestoftheday instacool

5 Seconds ago
Show Me The Real AFRICA (showmetherealafrica) Instagram Photos and Videos

Show Me The Real AFRICA

@showmetherealafrica


Comment from Show Me The Real AFRICA:


As these magnificent creatures wonder through Africa, they re-emphasise the fact it is the birthplace mankind. elephants history places botswana gaborone african ivory hunting beautiful views tradition kings queens kingdom kalahari desert wildlife worldplaces instagood picoftheday

5 Seconds ago
🗼Alice Blondie🗼 (rachelbleu4) Instagram Photos and Videos

🗼Alice Blondie🗼

@rachelbleu4


Comment from 🗼Alice Blondie🗼:


" Disfruta y no pienses más. . . " Iago Campa 😉 . Más sobre el look en el Blog , link directo en mi bio ). Después de un día con poquita energía , toca descansar . Feliz noche. ootdshareootd wiwt currentlywearing mylook look outfit lookoftheday outfitoftheday instalook instaoutfit fashion style stylish instafashion instastyle fashiondiaries streetstyle fashionblogger instablogger fashionista bloggermalaga blogger picoftheday instamood trendy fashiongram stylegram fashionlover

5 Seconds ago
Greta Scontrino (greta.scontri) Instagram Photos and Videos

Greta Scontrino

@greta.scontri


Comment from Greta Scontrino:


summer summernights hot blondehair blonde me nerdgirl nerd makeup love sweet polishgirl russiangirl asiangirl picoftheday photooftheday red lipstick instadaily daily getcreative rainbow girl passion

5 Seconds ago
Model, Cosplayer, Cat Girl (andromeda.neko) Instagram Photos and Videos

Model, Cosplayer, Cat Girl

@andromeda.neko


Comment from Model, Cosplayer, Cat Girl:


Did you know it's possible to booty dance to Depeche Mode? Well it is, and my Patrons get to see the whole thing 👿 patreonmodel gothgirl gothgoth gothfashion cosplaydeviants cosplaydeviant sexy lewdgirls instalike instagood girls erocosplay follow instadaily Altbabe altmodel modelsofinstagram naughtynerds girlswithink picoftheday anime

5 Seconds ago
DELIGHT 🔵 (mcdelight_dove) Instagram Photos and Videos

DELIGHT 🔵

@mcdelight_dove


Comment from DELIGHT 🔵:


Imagine a would without colour ⚫ The plants would be. But no relevance. Man would exist with no beauty. The sky would be with form but less definition. Human race would be. But nothing to explain its actual existence. Model Credit: D E L I G H T Model Instagram: @Mcdelight_dove Photo Credit: D E L I G H T Photographer IG: @Mcdelight_dove DM for bookings . . . uglygaintrain @localkasai @cash.flow @bolajo_few PulloutGt @localkasai @ikravelucy juicegaintrain modelscout balmain Cheezygains @jay.reigns modelshoot malemodelscene liyahandlucygain models malemodelscene malemodels modelo malemodeltrending silkfollowtrain BlackModel picoftheday @zaharamodels @re_models @fordmodelsscout @modelspolaroids scoutme @africanmodelshub @original_africans @modelsdiscovery @fusionmodelsnyc sparkygains LilBoatGains @Detta.DXN frenxygains @suckmykicks GloryFollowtrain Lucyganggains tastygain armorgains makeitgaintrain gainwithus

6 Seconds ago
Dev Kumar (officialdevkumar) Instagram Photos and Videos

Dev Kumar

@officialdevkumar


Comment from Dev Kumar:


Darkness only exist so that you can see the brightest stars shininig. ------------ model modeling model life fashion model photo pic art beautiful instagood picoftheday all shots exposure focus t capture fashion swag style me cute love hair hairlove live cool styles fresh

6 Seconds ago
Meitsky - Dittrich United Arts (mdunitedarts) Instagram Photos and Videos

Meitsky - Dittrich United Arts

@mdunitedarts


Comment from Meitsky - Dittrich United Arts:


Nice shooting with Jessy :) shooting picoftheday photography portrait portraits sonyalpha sony a7r 85mm woman face sun availablelight bokeh eyes mdunitedarts meitskydittrich geileswetter germany deutschland sachsen saxony oremountains erzgebirge schlettau

6 Seconds ago
Larissa Fernandes (larinha23f) Instagram Photos and Videos

Larissa Fernandes

@larinha23f


Comment from Larissa Fernandes:


Boa tarde✌ boatarde salvadormeuamor picoftheday photoafterday inxta inxtalove instabeauty fashionblogger blogueira tumblrgirl tumblr pinterest selfie avon maquiadora pausaparafeminices beauty makeup instagram

6 Seconds ago
Sae Rose (saenrose) Instagram Photos and Videos

Sae Rose

@saenrose


Comment from Sae Rose:


Yummy ~! 🍪 food foodporn cereals cereal picoftheday photooftheday photography elflako love

7 Seconds ago
Emma ♡ (int0agb) Instagram Photos and Videos

Emma ♡

@int0agb


Comment from Emma ♡:


Ifb arianagrande arianators arianator dangerouswoman gainpost gaintrick gainparty love singer love justinbieber nickiminaj like4like follow4follow spamforspam recent4recent instagood famous edit picoftheday fashion music madisonbeer madisonellebeer selenagomez selenator loveyou

7 Seconds ago
Tenis Room Medellin (tenis_room_medellin3) Instagram Photos and Videos

Tenis Room Medellin

@tenis_room_medellin3


Comment from Tenis Room Medellin:


ADIDAS SPEZIAL UNISEX🔝🔝 Por Solo $$160.000 (Todas las tallas) Tenis de la mejor calidad ☑️☑️ Rompemos el mercado con los mejores precios💰💰 Envios a todo el pais ✈️✈️ Domicilio gratis en Medellín ‼️ Wsp : 3117847982 love TFLers tweegram photooftheday 20likes amazing smile follow4follow like4like look instalike igers picoftheday food instadaily instafollow followme girl iphoneonly instagood bestoftheday instacool instago all_shots follow webstagram colorful style swaggerwagons

7 Seconds ago
Federico Muscas (vathras) Instagram Photos and Videos

Federico Muscas

@vathras


Comment from Federico Muscas:


picoftheday instaface gym sardinia italy home goingtothegym gymlover gymlife healtylifestyle beard men muscles bodybuilding fit fitness hot sexy eyes protein protein getbig aesthetic squat training trainingday

7 Seconds ago
ZeYNep🎨 (@_zynpalbayrak_) (renkliboyam) Instagram Photos and Videos

ZeYNep🎨 (@_zynpalbayrak_)

@renkliboyam


Comment from ZeYNep🎨 (@_zynpalbayrak_):


Nasıl yapsam acaba🤔 Duvar bugün bitmeliydi😅 👉 Tüm ürünlere profilimdeki linke tıklayıp üye olarak sahip olabilirsiniz duvarboyamastencilrichcraftcad ftcadencecraftkendinyapdiyelem yelemeğiinsatgoofinstalikelike

8 Seconds ago
Antonio Querol (antonio.querol) Instagram Photos and Videos

Antonio Querol

@antonio.querol


Comment from Antonio Querol:


Castellón ignoto (4) Otra vez Castellón, pero, donde es ?? Castellón de la Plana (Castellon) ============================== photooftheday picoftheday instadaily bestofthedayinstagood beautiful amazing beautiful ============================== pueblos towns sunrise_sunsets_aroundworld sunrise ============================== turismevalencia valenciabonita valenciagrafias valenciagram valenciabonita_insta Igerscs igers ============================== spain 2017 ==============================

8 Seconds ago
Andrea Cartapatti (andreacartapatti) Instagram Photos and Videos

Andrea Cartapatti

@andreacartapatti


Comment from Andrea Cartapatti:


veneto vigne e nuvole Prosecco vino spumante glera colline valdobbiadene treviso paesaggio nofilter nofilterneeded campagna vigna igerstreviso alimentalabellezza picoftheday like4like wine winestagram winelover bubble winetime wineoclock foodandbeverage me lovemyjob perdereunsaporeèperdereunsaper

8 Seconds ago
Mar Vercher🖤 (deperdidasalarmario) Instagram Photos and Videos

Mar Vercher🖤

@deperdidasalarmario


Comment from Mar Vercher🖤:


L👀K 🔝 ootd outfit outfitoftheday look lookoftheday lookbook inspiration fashion fashionblogger fashionista fashionable style streetstyle zara converse moda instagood instadaily instagramers post daily picoftheday m

9 Seconds ago
ManuelCossiga (manuelcoss94) Instagram Photos and Videos

ManuelCossiga

@manuelcoss94


Comment from ManuelCossiga:


Il periodo migliore ...niente urla niente rotture di scatole ..solo il rumore del mare 👍

11 Seconds ago
Maxime (_maximexx) Instagram Photos and Videos

Maxime

@_maximexx


Comment from Maxime:


Slowly getting somewhere! 💥 What do you love most about your body? 😊

11 Seconds ago
(No Original Memes) (clouticus) Instagram Photos and Videos

(No Original Memes)

@clouticus


Comment from (No Original Memes):


13 Seconds ago
HANNAH (estesh) Instagram Photos and Videos

HANNAH

@estesh


Comment from HANNAH:


just can't beat this coastline.

48 Seconds ago
Federica Rizzo (fede3784) Instagram Photos and Videos

Federica Rizzo

@fede3784


Comment from Federica Rizzo:


Val d' Orcia...italy Italia tuscany toscana amazing sky skyporn landscape hills holidays family travel nature instanature instatravel instamoment instalife instalike instapassport instalove love instapic bestoftheday picoftheday discovertuscany igers igdaily igerstoscana aroundsiena instatoscana @ig_italia @igerssiena @discovertuscany @aroundsiena

52 Seconds ago
Steak & Teeth: Halal Food Blog (steakandteeth) Instagram Photos and Videos

Steak & Teeth: Halal Food Blog

@steakandteeth


Comment from Steak & Teeth: Halal Food Blog:


A cupcake a day keeps the sadness away. Sugary goodness from @bakestreetldn / @everingcake. Who else needs a sugar rush to get them through the week? 😪🍰 . halalblogger foodblogger cake cupcake cafe SteakAndTeeth SAT

1 Minutes ago
Artist & Craftsman Supply (artistcraftsman_dc) Instagram Photos and Videos

Artist & Craftsman Supply

@artistcraftsman_dc


Comment from Artist & Craftsman Supply:


Heads up!!! 4 spots left for our Copic marker workshop with @the.soto this Sunday from 3-5pm😄🎨. Call us at 202-526-4446 or stop by to sign up! Class is $20 and all supplies are included. Kids ages 10 and up may also join. See you re!

2 Minutes ago
Nastya (a.mildi) Instagram Photos and Videos

Nastya

@a.mildi


Comment from Nastya:


love instagood me tbt cute follow followme photooftheday happy beautiful selfie picoftheday like4like instagramanet instatag smile friends fun fashion summer instadaily igers instalike swag amazing tflers follow4follow likeforlike bestoftheday l4l

4 Minutes ago
|BEATRIZ MARTÍNEZ| (beatriz1555) Instagram Photos and Videos

|BEATRIZ MARTÍNEZ|

@beatriz1555


Comment from |BEATRIZ MARTÍNEZ|:


🔳¡SORTEO! 🔳 De nuevo os traigo un sorteo en mi cuenta. Esta vez podéis conseguir este maravilloso neceser para guardar los productos de vuestro bebe o incluso vuestras cosas y el aceite para después del baño. PARA PARTICIPAR ⬇ . 🔼 Serguirme a mi ( @beatriz1555) y a @nubelhandmade 🔼 MG en la foto 🔼 Comenta la foto mencionado a 3 amig @s (no repetir nombre, blogger, famoo) . El orteo finaliza el 27 de eptiembre ✨

39 Minutes ago