Search Tagsfor aesthetics

arestetik (arestetikonline) Instagram Photos and Videos

arestetik

@arestetikonline


Comment from arestetik:


Yüz germe ameliyatı genel anestezi altında yapılır. Ameliyatta ihtiyaca göre yüzün belli bölgelerine yağ enjeksiyonu da yapılır. estetik aesthetics yüzgerme estetikcerrahi plasticsurgery nişantaşıestetik nişantaşı

13 Seconds ago
Benny  Hurst (benefit_powerhouse) Instagram Photos and Videos

Benny Hurst

@benefit_powerhouse


Comment from Benny Hurst:


Good to have our boy @jbak_j back on that gain train and part of our powerhouse family 💙💪🏼💯 @james_ormsby @tomdoigsupps @giantsportsinternational_au @giantsportsinternational_nz @scivation_nz @scivation_au @buffbake_nz @buffbake_au Team collective 🙌🏼❤️ @powerhousegym_tsv @platinummealprep powerhousegym teamgifted aesthetics ifbb inba wbff instafit igfitness instalike scivation instabeard inspiration instatattoo instagallery instagramhub beastmode bodybuilding muscle motivation picofday photoftheday squat shredded tattoo fitfam fitspo fitnessmotivation fitnessmodel

14 Seconds ago
rachael (heysmols) Instagram Photos and Videos

rachael

@heysmols


Comment from rachael:


's post. - 🎀🎀Cosplay🎀🎀 - Okay Kiddos!!! These are the next costumes I am going to make. I might do a few costest things, but beyond that these are my planned characters. I am currently working on Coraline, so I might post some of that soon!! - Tags ;; BlackAndWhite Aesthetics Cosplay Cosplayer MultiFandom GroupCosplay Cosplaying Cosplays Costest YunoGasai YunoCosplay YandereChan YandereCosplay Coraline CoralineCosplay MikanTsumiki MikanTsumikiCosplay

15 Seconds ago
Cleyson Garcia Velasquez (heycat_7) Instagram Photos and Videos

Cleyson Garcia Velasquez

@heycat_7


Comment from Cleyson Garcia Velasquez:


abs aesthetics amazing body bodybuilding exercise fit fitfam fitlife fitspo fitness fitnessaddict fitnessmodel fitnessmotivation gym gymlife ifbb instafit instafitness lift muscle motivation npc physique ripped shredded sixpack training wbff

25 Seconds ago
CALISTHENICS 🔹HEALTH 🔹MINDSET (jamesmacris) Instagram Photos and Videos

CALISTHENICS 🔹HEALTH 🔹MINDSET

@jamesmacris


Comment from CALISTHENICS 🔹HEALTH 🔹MINDSET:


Round 6 of the jamesvsmark weekly challenge against @mark_edward_g is back!! 🔥🔥🔥This weeks challenge was: who can do the highest superman push-up? 🏆Who do you think won? 🏆We declared it a draw because it was so close making the score 4-3 my way 😋❤️🙏🏽

33 Seconds ago
Stallion Sports (stallionsportsuk) Instagram Photos and Videos

Stallion Sports

@stallionsportsuk


Comment from Stallion Sports:


Today's home workout, triple tap to save. 💪🏾👊🏾🏋🏽 calisthenics bodybuilding aesthetics motivation strength fitness fitfam inspiration gym hardwork muscle abs instafit workout fitnessmotivation dedication physique follow eatclean gains athlete determination beastmode trainhard bodybuildingmotivation doyouevenlift getfit fitspo gymlife healthychoices

38 Seconds ago
ruby vella (rubyfitfoodie) Instagram Photos and Videos

ruby vella

@rubyfitfoodie


Comment from ruby vella:


Repost @rubysephora_figure with @repostapp ・・・ - ____ ______________________ Follow my continual journey with big goals & dreams. Sharing the realness & rawness of BTS off season and prep.... . Insta: @rubysephora_figure Snap: rubysephora YouTube : Ruby Jessica Fitness . lifeafterprep lifeafterarnolds .commitment aesthetics motivation lifestyle compprephadmelike gym progress dontquit mindset goals achieve fit fitness fitfam muscle mentality inspiration dedication exercise workout work cardio food complife positivity abs squats

40 Seconds ago
ihara kento (kento1177) Instagram Photos and Videos

ihara kento

@kento1177


Comment from ihara kento:


shoulderday 💪 んー難しい😵 motivationphysique bodybuilding aesthetics workout muscles bodyfitnessfollowme trip familyhellogoldsgymgymfitspo筋トレ筋肉トレーニングフィットネスworkoutsトレーニングtraining 훈련근육swagswagger gymflowgymclothesdiet

41 Seconds ago
Javier Pulido (javierpulido69) Instagram Photos and Videos

Javier Pulido

@javierpulido69


Comment from Javier Pulido:


POST-ENTRENO: . 👉 Batido de vainilla-miel: 30gr Proteína de concentrado de suero de leche sabor vainilla-miel + 5gr Creatina monohidrato + 500mL Agua . Para ASESORAMIENTO ONLINE PERSONALIZADO ↪ javierpulido69 @gmail.com . Snack Fitness Abs Cutting Gym BodyBuilding Fit Physique MensPhysique Bulking Muscle Protein Ripped Aesthetics IIFYM Motivation Inspiration Transformation Dedication WorkOut Healthy FitnessAddict InstaPic PicOfTheDay SixPack Yummy Gains NoPainNoGain GymLife FitnessModel

42 Seconds ago
 (athletic_teen) Instagram Photos and Videos

athletic_teen

@athletic_teen


Comment from athletic_teen:


mcfitnattygainsaestheticssatiregymprobrowearprobroarmygymaestheticsgestörtaufpumpabgerechnetwirdamstrandmyproteingymgenerationnessentialwayoflifesmilodoxgymjunkyfitnessfreakfitnessaddictgymworkoutbeastmodeflexfitnessfitnessmodelfitnesslifestylefitxfitfamnaturalbodybuildingbiceps athletic_teen

43 Seconds ago
ANBF & NGA Pro Michael Dalton (daltonegger) Instagram Photos and Videos

ANBF & NGA Pro Michael Dalton

@daltonegger


Comment from ANBF & NGA Pro Michael Dalton:


transformationtuesday 2012 vs 2016 Keep your confidence no matter what shape you're in, friends. 240 vs 170. Pizza-ready or contest-ready? Give it your all

45 Seconds ago
A R M O (armobrah) Instagram Photos and Videos

A R M O

@armobrah


Comment from A R M O:


Blood sweat and tears have been put into my physique...so fuck yeah I'll show it off with pride. . . classicphysique2018 . . lafitness hollywood squadgoals built builtapparel l4l likenow followforfollow f4f picoftheday mirin zyzz bodybuilding aesthetics fuark muscles flex bicep abs cutiesonly justharutthings halfnatty armenian genetics hollywoodblvd summer

46 Seconds ago
Clément Yap's 23 yo 🇫🇷 (yapsssss) Instagram Photos and Videos

Clément Yap's 23 yo 🇫🇷

@yapsssss


Comment from Clément Yap's 23 yo 🇫🇷:


Séance épaules ce matin, la meilleure ! 🔥💫 Bonne journée ✌🏻 🔸 👻 Snapchat: clempsg ☠ Team @atout_sport_64 💵 France Paris (5€ gratuit et 100€ bonus sur le premier paris code YAPS) 🔸

50 Seconds ago
Clayton Hockley (clayton_nzmuscle) Instagram Photos and Videos

Clayton Hockley

@clayton_nzmuscle


Comment from Clayton Hockley:


First boxing session done with my lil coach @mystique.fitness 👊👊 only died thrice and complained once... jk the entire time 😂😂 Boxing MyLilBoxer SheWillKickMyAss ImALilScared SheOutAngledMe

58 Seconds ago
Owen (owenlam_) Instagram Photos and Videos

Owen

@owenlam_


Comment from Owen:


Dirty mirror and dirty shoes.

1 Minutes ago
Michael Huth (zeptioneer_official) Instagram Photos and Videos

Michael Huth

@zeptioneer_official


Comment from Michael Huth:


Schaut gern vorbei :) fitfam sport transformation motivation follow4follow fitness tbt instafit instagood bodybuilding aesthetic aesthetics f4f i love healthy like4like l4l natural pic picoftheday girl friendship success selfie friend nutrition instagram model likeforlike

1 Minutes ago
Brendan Regnier-Berat Reis (brendanreisss) Instagram Photos and Videos

Brendan Regnier-Berat Reis

@brendanreisss


Comment from Brendan Regnier-Berat Reis:


1 hour transformation...no pump vs. pump 😭 1 saatlik degisim. Pump ve pumpsiz olmanin farki budur. Mucize gibi ulan

1 Minutes ago
Athléte IFBB Competitor (oscar_vzc) Instagram Photos and Videos

Athléte IFBB Competitor

@oscar_vzc


Comment from Athléte IFBB Competitor:


💪 Follow @oscar_vzc For in-person & online personal training. Contact me today by clicking the blue "Contact" Button in my BIO . . . . travel travelphotography bodybuilding aestheticsmotivationdiet fitnesscoaching  gym  absinstafitworkoutfitnessmotivation couple  instafit  followgirlscoach couplegoals bodybuildingmotivationinstafitness  followforfollow fitnessmodels beauty love coffee coffe read beach picoftheday

1 Minutes ago
Live in Milan,🇮🇹 (bernardo_personalcoach) Instagram Photos and Videos

Live in Milan,🇮🇹

@bernardo_personalcoach


Comment from Live in Milan,🇮🇹:


Beast MODE:ON! 💪🔝 gymlife photooftheday health fitness fit fitnessmodel fitnessaddict fitspo workout bodybuilding cardio gym train training aesthetics cuban cubano muscle shredded squat bigbench animal

1 Minutes ago
Ben Willcocks (benwillcocks1) Instagram Photos and Videos

Ben Willcocks

@benwillcocks1


Comment from Ben Willcocks:


I think I might need a haircut... morning outtacontrol aesthetics best fit fitfam fitness gym passion love instafit dedication motivation hair

1 Minutes ago
Gian Franco Sanguinetti (gspersonaltrainer) Instagram Photos and Videos

Gian Franco Sanguinetti

@gspersonaltrainer


Comment from Gian Franco Sanguinetti:


GP delle Alpi CIBB,categoria Fitness Model.Arrivo alla finale dell'11 giugno con due 1º classificato,motivato e con una condizione che mi permetterà di arrivare da finalista anche come Men's Physique,dove il livello sarà molto alto.Intanto,un po' di posing... cibb gpdellealpi piossasco posing routine fitness model modeling muscle aesthetic aesthetics gym gymlife bodybuilding abs pump costume instalike instafitness likeforfollow like4like lifestyle sport healthy fashion

1 Minutes ago
CrossFit Singapore Bootcamp (crossfit_singapore_bootcamp) Instagram Photos and Videos

CrossFit Singapore Bootcamp

@crossfit_singapore_bootcamp


Comment from CrossFit Singapore Bootcamp:


What do you think fitness is about? . CrossFitSG CrossFitSingapore CrossFitBootcamp CrossFitSingaporeBootcamp Bootcamp SGBootcamp SingaporeFitness sgfitness fitspiration nopainnogain fitness running aesthetics sgaesthetics strength conditioning singapore tuesdaymotivation

1 Minutes ago
Robert walbank (rwalbank88) Instagram Photos and Videos

Robert walbank

@rwalbank88


Comment from Robert walbank:


Amen

1 Minutes ago
Teen Athletics (teenathletics) Instagram Photos and Videos

Teen Athletics

@teenathletics


Comment from Teen Athletics:


Quality💯💯

1 Minutes ago
 (athletic_teen) Instagram Photos and Videos

athletic_teen

@athletic_teen


Comment from athletic_teen:


mcfitnattygainsaestheticssatiregymprobrowearprobroarmygymaestheticsgestörtaufpumpabgerechnetwirdamstrandmyproteingymgenerationnessentialwayoflifesmilodoxgymjunkyfitnessfreakfitnessaddictgymworkoutbeastmodeflexfitnessfitnessmodelfitnesslifestylefitxfitfamnaturalbodybuildingbiceps athletic_teen

1 Minutes ago
eva 🍂 (evasaesthetic) Instagram Photos and Videos

eva 🍂

@evasaesthetic


Comment from eva 🍂:


✨ this theme is about to be trash but oh well ✨

1 Minutes ago
Jordan (jordantnk) Instagram Photos and Videos

Jordan

@jordantnk


Comment from Jordan:


gymshark bodybuilding fitness instafit fitfrenchies fitfam fitfamily shredded lifestyle gym gymmotivation like4like instadaily fitspo workout aesthetic aesthetics boy fitnessaddict picoftheday tattoo tattooed beard body likeforlike likeforlikes like4follow likes4likes likeforfollow black

2 Minutes ago
 (athletic_teen) Instagram Photos and Videos

athletic_teen

@athletic_teen


Comment from athletic_teen:


mcfitnattygainsaestheticssatiregymprobrowearprobroarmygymaestheticsgestörtaufpumpabgerechnetwirdamstrandmyproteingymgenerationnessentialwayoflifesmilodoxgymjunkyfitnessfreakfitnessaddictgymworkoutbeastmodeflexfitnessfitnessmodelfitnesslifestylefitxfitfamnaturalbodybuildingbiceps athletic_teen

2 Minutes ago
Lizi Gabrichidze🌹 (liziigab) Instagram Photos and Videos

Lizi Gabrichidze🌹

@liziigab


Comment from Lizi Gabrichidze🌹:


2 Minutes ago
Dan Francis #LeaveALegacy (danfrancis83) Instagram Photos and Videos

Dan Francis #LeaveALegacy

@danfrancis83


Comment from Dan Francis #LeaveALegacy:


This is path society, our teachers, our parents, our grandparents teach us. Go to school, get an education, further that education, Go to work, get a career you can work 9-5 for 40/50 years, Retire and spend time with your family. Or...... Learn from successful people who have money and freedom, Spend time with your family, Retire when you like, Spend your years enjoying life with no restrictions! Are you living for the salary or living off commissions and profits? What's going to benefit you? A capped salary or uncapped commissions and profits??

2 Minutes ago
Skincare & Teeth Whitening (skinisin1) Instagram Photos and Videos

Skincare & Teeth Whitening

@skinisin1


Comment from Skincare & Teeth Whitening:


My skin is fresh and glowing thanks to regular peels and my dermaroller treatment every 6 weeks. Contact me for more information! beauty londonbeauty facial bromley chislehurst london ledtherapy beckenham galvanic highfrequency bromley kent essex microdermabrasion dermaroller londonbeauty skin mobile dermapen beautytherapist chemicalpeel aha glycolic essexbeauty aesthetics

2 Minutes ago
황 철 chul hwang (hwangchul2) Instagram Photos and Videos

황 철 chul hwang

@hwangchul2


Comment from 황 철 chul hwang:


대회 애쓰는구나 보니까.. 역시 @hyungseongpark 형의 펌핑은🤤🤤ㅋㅋ

2 Minutes ago
Rebecca V. 1m64 (rebecca.fit17_healthy) Instagram Photos and Videos

Rebecca V. 1m64

@rebecca.fit17_healthy


Comment from Rebecca V. 1m64:


RIP Soutien à manchester attentat ! On pense à vous ! Et en plus pendant un concert d'une idole arianagrande

3 Minutes ago