Search Tagsfor dm

Tess (ttess_) Instagram Photos and Videos

Tess

@ttess_


Comment from Tess:


Send me promos and tracks! ElectricLine SocialMedia communitymanager DM electronicmusic

41 Seconds ago
Sage Listen (sage_listen_poet) Instagram Photos and Videos

Sage Listen

@sage_listen_poet


Comment from Sage Listen:


Ok yall. We def have vendors spaces still available. If you havent booked your table yet there is still time. clickthelinkinmybio . Food vendors are def welcome. We love to eat. dm me for details. BLESSINGS Kings and Queens

47 Seconds ago
Palak Kusumakar (palak_enterprise__) Instagram Photos and Videos

Palak Kusumakar

@palak_enterprise__


Comment from Palak Kusumakar:


Polka bangles 🤗🤗 Dm for orders😁

59 Seconds ago
ceo of @60secofpain (__hightimez_) Instagram Photos and Videos

ceo of @60secofpain

@__hightimez_


Comment from ceo of @60secofpain:


DM NOTT COMMENT MFS RETARDED LETS GO🤔

1 Minutes ago
Pintér Tünde (pintertunde02) Instagram Photos and Videos

Pintér Tünde

@pintertunde02


Comment from Pintér Tünde:


scitec dm 😍🦄🍫

1 Minutes ago
윤비 (y1992v) Instagram Photos and Videos

윤비

@y1992v


Comment from 윤비:


기부니가 좋으니 재탕스트!!!! . . . 재탕셀스타그램셀기꾼일상소통일상선팔맞팔셀피셀카새벽일산부평김포다이렉트옷샾커밍순selfieselcadmf4fl4l

1 Minutes ago
hey ❤ (martinez_my_world) Instagram Photos and Videos

hey ❤

@martinez_my_world


Comment from hey ❤:


1 Minutes ago
ah__kung (ah__kung) Instagram Photos and Videos

ah__kung

@ah__kung


Comment from ah__kung:


쿵필름 x YU . 그래 그런거야.. . . filmfilmcameraanalogsnapgirlportrait스냅사진감성스냅일상필름인친필름사진인물사진감성사진일반인모델인물소녀여행출사사진개인촬영촬영문의DM추억팔로전주군산익산

1 Minutes ago
혜리 (hyeeel._.19) Instagram Photos and Videos

혜리

@hyeeel._.19


Comment from 혜리:


일주일 뒤면 해방이야 빼앰 ~ . . . . Insta instagram instagood instaselfie selfie 셀카 셀스타그램 얼스타그램 고등학생 99년생 고3 고쓰리 19살 98 99 00 18살 19살 20살 l4l like4like follow followme follow4follow 선팔 맞팔 다렉 DM

1 Minutes ago
세빈🌸 (sebin4643) Instagram Photos and Videos

세빈🌸

@sebin4643


Comment from 세빈🌸:


아 엄청단거 먹고싶어 - - - 여고생디엠 다렉 다이렉트 훈녀 얼스타그램화장 일상메이크업 셀카 셀피 셀스타그램 고2 고3오늘의훈남 훈남 선팔 맞팔 인친 맞팔은댓글 선팔맞팔 makeup dm direct pretty daily selfie selstagram f4f

1 Minutes ago
yeniden doğuş 💪 (venharla_yenidendgs) Instagram Photos and Videos

yeniden doğuş 💪

@venharla_yenidendgs


Comment from yeniden doğuş 💪:


sağlıksporfitnessbeslenmekiloverdmdirectmutlulukkayserisivasankaraizmirbolukırşehirsamsunaydınmersinkilolaravedaopersatiyatrounuversite ❗❗❗ Kilonuz ↔ kader ↔ degildir...❗ Degisim seninle başlar.. Karar ver başlayalım.. YAZA FİT OLALIM 😊 Aç kalmadan ↔ diyet yapmadan ↔ sarkmadan ↔ yorulmadan saglikli beslenerek sizde fazlaliklarinizdan kurtulabilirsiniz😉 Detaylı bilgi ve siparis icin WATSAPP : 📞 0 (507)9069634

1 Minutes ago
yeniden doğuş 💪 (venharla_yenidendgs) Instagram Photos and Videos

yeniden doğuş 💪

@venharla_yenidendgs


Comment from yeniden doğuş 💪:


sağlıksporfitnessbeslenmekiloverdmdirectmutlulukkayserisivasankaraizmirbolukırşehirsamsunaydınmersinkilolaravedaopersatiyatrounuversite ❗❗❗ Kilonuz ↔ kader ↔ degildir...❗ Degisim seninle başlar.. Karar ver başlayalım.. YAZA FİT OLALIM 😊 Aç kalmadan ↔ diyet yapmadan ↔ sarkmadan ↔ yorulmadan saglikli beslenerek sizde fazlaliklarinizdan kurtulabilirsiniz😉 Detaylı bilgi ve siparis icin WATSAPP : 📞 0 (507)9069634

2 Minutes ago
yeniden doğuş 💪 (venharla_yenidendgs) Instagram Photos and Videos

yeniden doğuş 💪

@venharla_yenidendgs


Comment from yeniden doğuş 💪:


sağlıksporfitnessbeslenmekiloverdmdirectmutlulukkayserisivasankaraizmirbolukırşehirsamsunaydınmersinkilolaravedaopersatiyatrounuversite ❗❗❗ Kilonuz ↔ kader ↔ degildir...❗ Degisim seninle başlar.. Karar ver başlayalım.. YAZA FİT OLALIM 😊 Aç kalmadan ↔ diyet yapmadan ↔ sarkmadan ↔ yorulmadan saglikli beslenerek sizde fazlaliklarinizdan kurtulabilirsiniz😉 Detaylı bilgi ve siparis icin WATSAPP : 📞 0 (507)9069634

2 Minutes ago
Alisa (aliiiii_nice) Instagram Photos and Videos

Alisa

@aliiiii_nice


Comment from Alisa:


Shoppingdayfreiermittagwednesdayh&mdmdouglas💅🛍🎀

2 Minutes ago
yeniden doğuş 💪 (venharla_yenidendgs) Instagram Photos and Videos

yeniden doğuş 💪

@venharla_yenidendgs


Comment from yeniden doğuş 💪:


sağlıksporfitnessbeslenmekiloverdmdirectmutlulukkayserisivasankaraizmirbolukırşehirsamsunaydınmersinkilolaravedaopersatiyatrounuversite ❗❗❗ Kilonuz ↔ kader ↔ degildir...❗ Degisim seninle başlar.. Karar ver başlayalım.. YAZA FİT OLALIM 😊 Aç kalmadan ↔ diyet yapmadan ↔ sarkmadan ↔ yorulmadan saglikli beslenerek sizde fazlaliklarinizdan kurtulabilirsiniz😉 Detaylı bilgi ve siparis icin WATSAPP : 📞 0 (507)9069634

2 Minutes ago
sextoys available here (sextoys_4_uh_in_india) Instagram Photos and Videos

sextoys available here

@sextoys_4_uh_in_india


Comment from sextoys available here:


Capsular vibrator Dm for buying

2 Minutes ago
Sage Listen (sage_listen_poet) Instagram Photos and Videos

Sage Listen

@sage_listen_poet


Comment from Sage Listen:


Ok yall. We def have vendors spaces still available. If you havent booked your table yet there is still time. clickthelinkinmybio . Food vendors are def welcome. We love to eat. dm me for details. BLESSINGS Kings and Queens

2 Minutes ago
maya💫 (mabeautybl0g) Instagram Photos and Videos

maya💫

@mabeautybl0g


Comment from maya💫:


Hab mir heute ein paar Masken gekauft😊 Ich hab auch gleich die Balea SOFT & CLEAR Anti-Pickel Peel-Off Maske getestet😄 Und ich muss sagen....ich bin sehr überrascht, die Maske entfernt tatsächlich Mitesser, aber trocknet leider nur sehr langsam. ¤ Auf dem Bild sind noch die - Schaebens Luxus Maske - Balea Totes Meer Maske -Balea Weisser Tee & Kirsche Maske - Balea Melone Creme-Gel Maske beautymaskenbaleaschaebensbeautygurubeautyblogdmbeautylovetested

2 Minutes ago
jun (june_911) Instagram Photos and Videos

jun

@june_911


Comment from jun:


해외직구.쇼핑.블로그마켓.명품등등 블로그 창업해보실분 모집합니다^^ 딱 5분만 배송부터 셀렉.방법등등 케어 해드릴 예정입니다 창업비용은 0원입니다.👍 집에서 띵가띵가 남편이 돈 벌어다주지만 애기때문에 집콕하며 아쉽고 미안한 육아맘 직장은 다니지만 벌이가 적어서 투잡 을 하고싶은데 뭘모르는 직장인 의류.옷.가방.수입 등등 관심많고 의욕많은 젊은 여성분 등등~ 5명만 모집해서 모든걸 알려드리께요. 그렇다고 아무나해주진 않을거구 의욕이 있는분만 ㅇㅇ 수익은 저같은경우 많을땐 월 1천까지도 가능했고 쉬엄쉬엄 투잡으로 하셔도 월 300은 😃 본업 보다 더 나은 투잡 재테크 자세한건 DM 부산 전국 일상 투잡 쇼핑 블로그마켓

2 Minutes ago
eiweissgeier (eiweissgeier) Instagram Photos and Videos

eiweissgeier

@eiweissgeier


Comment from eiweissgeier:


🍽mealprep -Time zum Bergfest dieser Woche. Diesmal von @markus_fit_statt_fett. Ganz oldschool-mäßig mit Hähnchen, Reis und Magerquark 💪🏻🍗🍚Dazu noch als Snacks Eiweiss-Riegel von @dm_deutschland . 🤗Wir wünschen guten Appetit und eine super Restwoche. Bleibt motiviert💪🏻 eiweiss eiweissriegel eiweissgeier reis rice chicken hähnchenbrust hähnchen walnuss paprika nüsse nuts protein dmdrogerie dm mealprep mealprepgermany pumpen fitness gym lifegoals bergfest yummy gutenappetit lecker schmeckt motivation staymotivated

3 Minutes ago
follows you (active.lord) Instagram Photos and Videos

follows you

@active.lord


Comment from follows you:


Lol 😂😂😂 . recent rfr spamforfollow spam4spam like4like lfl recent4recent recentforrecent r4r sfslikeforlikes tbhratesSnapchatcfccashfollowplane jaygainplane jaylegit followtrain gainpost helpcash dt DM godlygaintrain gairecent rfr spamforfollow spam4spam lfl recent4recent recentforrecent r4r sfslikeforlikes tbhratesSnapchatcfccashfollowplane jaygainplane jaylegit followtrain gainpost helpcash dt DM mixe @dopest_wayne @dopest.wayne @lit.tunde @mzjoy_ekere_ @bae.amor @lit_emmy @yur_village_people @one2dy4

3 Minutes ago
 (beaut1fulgirls) Instagram Photos and Videos

beaut1fulgirls

@beaut1fulgirls


Comment from beaut1fulgirls:


@tita.hy InstaSize follow followme followher sfs s4s shoutout finnishgirl follow followme followher sfs s4s shoutout finnishgirl kikkailkaa potkikaa snäppäilkää snäpchat snäpme kik kikmessenger kikme swedishgirl swedishgirls finnishgirls russiangirl russiangirls instagood tagsforlikes photooftheday tbt picoftheday bestoftheday dm

3 Minutes ago
Lantana Doğal Taş (lantanadogaltas) Instagram Photos and Videos

Lantana Doğal Taş

@lantanadogaltas


Comment from Lantana Doğal Taş:


Aytaşıyaşlanmıs aytaşıdegerliistenilen model yapılırdm den iletisime geciniz Aytaşı, ying ve yang dengesini saglar. Hucreleri yeniler. Nazara karşı kalkan gorevi gorur. Hamilelikte hormonal dengeyi sağlar.

3 Minutes ago
이상희 | Sanghee Lee 🇰🇷 (lees2anghee) Instagram Photos and Videos

이상희 | Sanghee Lee 🇰🇷

@lees2anghee


Comment from 이상희 | Sanghee Lee 🇰🇷:


오렌지 안 먹은 지 얼마나 오렌지

3 Minutes ago
보은 (8oeun) Instagram Photos and Videos

보은

@8oeun


Comment from 보은:


💯 . . . 인스타그램 셀스타그램 집 daily 선팔하면맞팔 소통 좋아요 댓글 dm

3 Minutes ago
sextoys available here (sextoys_4_uh_in_india) Instagram Photos and Videos

sextoys available here

@sextoys_4_uh_in_india


Comment from sextoys available here:


LIBO G-Spot Sagittarius massager Dm for buying

3 Minutes ago
Miquel Mattis (lit.xtreme) Instagram Photos and Videos

Miquel Mattis

@lit.xtreme


Comment from Miquel Mattis:


Who Wear It Better?👚👗 Dont Scroll Down Just Double Tap And Tag A Friend recent r4r spamforfollow spam4spam like4like lfl recent4recent recentforrecent r4r sfs likeforlike tbh rates snapchat cfc cashfollowplane jaygainplane jaylegit followtrain gainpost gainparty helpcash dt DM mixedarianafollowtrain godlygaintrain gai recent rfr spamforfollow spam4spam like4like lfl recent4recent recentforrecent r4r sfs likeforlikes tbh rates snapchat cfc cashfollowplane jaygainplane jaylegit followtrain gainpost helpcash dt DM mixedarianafollowtrain gainwithlitxtreme @lit_teaser @will_ent @meazy_squad @lit.prime @bae.armor

4 Minutes ago
bir duble huzur (birdublehuzur) Instagram Photos and Videos

bir duble huzur

@birdublehuzur


Comment from bir duble huzur:


Takip için @birdublehuzur @birdublehuzur @birdublehuzur Arkadaşlarınızı yoruma etiketlemeyi unutmayın... sevgi leylailemecnun askkeremileaslı kaybedenlerkulübü ıssızadam şiirsokakta şiir siirheryerde şiirherşeydir dm mutluluk huzur birdubleaşk mutluluk istanbul izmiriyigeceler günaydın birdublerakı acı hüzün ilhanberk ahmetkaya ahmetarif takibetakip sohbet mardin necipfazılkısakürek cemalsüreyya

4 Minutes ago
The Coffee Bubble (coffeebubble_) Instagram Photos and Videos

The Coffee Bubble

@coffeebubble_


Comment from The Coffee Bubble:


word followforfollow likeforlike dm comment love iwillhear whatwillyousay

4 Minutes ago
채린 (cofls525w) Instagram Photos and Videos

채린

@cofls525w


Comment from 채린:


핑크렌쥬 셀스타그램 얼스타그램 셀스타 얼스타 셀카 셀피 셀기꾼 01년생 99 00 01 2001년생 고1 인친환영 인친 일상 소통 천안 피드 선팔 맞팔 맞팔환영 언팔싫어요 DM selfie f4f followme lfl

4 Minutes ago
경민 (gyeongmin_05_09) Instagram Photos and Videos

경민

@gyeongmin_05_09


Comment from 경민:


인스타그램 글스타그램 맞팔 선팔 팔로우 follow 99 98 20 19 글 감성 감성글 감성사진 취미 , , 글 쓰고 싶어서 그러는데 예쁜 풍경,하늘 사진 공유해 주실분~~ DM

4 Minutes ago
only boobs 🔥 (onlymyboobs_) Instagram Photos and Videos

only boobs 🔥

@onlymyboobs_


Comment from only boobs 🔥:


Follow @emmebrulee 🔥💋💋💋 dm girl hot dmme selfie onlymy

4 Minutes ago
#Hediyen Kupa Olsun## (kisiye_ozel_kupa) Instagram Photos and Videos

#Hediyen Kupa Olsun##

@kisiye_ozel_kupa


Comment from #Hediyen Kupa Olsun##:


HEDİYELİK ĶİŞİSEL KUPA BARDAK İSTEDİGİNİZ GİBİ TASARLAYALIM DM GÖNDERMENİZ YETERLİ HAVALE -EFT ANNELER GÜNÜ SEVGİLİLER GÜNÜ DOGUM GÜNÜ TÜM ÖZEL GÜNLER HER YERE GÖNDERILİR

4 Minutes ago