Search Tagsfor pendakicantik

Dwi Radial (radialdwi) Instagram Photos and Videos

Dwi Radial

@radialdwi


Comment from Dwi Radial:


Bukit Sebayan 🏞 📌 Location: Dusun Jeramun, Desa Sejotang, Kecamatan Tayan Hilir, Kabupaten Sanggau, Kalbar. Indonesia ⚠ketinggian: sekitar 536mdpl. 🔄Repost : @pendakikalbar 📷Photo by : @aprillia_aky ❗Sebelum mendaki, harus izin dulu ke Kepala Dusun Jeramun kecamatan Tayan. 〰〰〰〰〰〰〰〰〰〰〰 pendakikalb bukitsebayan pendaki_kalimantan pendakiindonesia pendakicantik pendakihijabers pendakikeren mountains gunungindonesia intapendaki instagunung idpendaki pemudapetualangtayanhilir stayborneo sukelalu awesome jelajahgunung jejakpendaki mdplindonesia pendakimerahputih exploregunung pesonapendaki pesonapendaki momen_pendaki explorependaki indomountaineer

36 Seconds ago
Gelang Prusik, Gelang Jangkar (onanoshop) Instagram Photos and Videos

Gelang Prusik, Gelang Jangkar

@onanoshop


Comment from Gelang Prusik, Gelang Jangkar:


Kode FJ032 Harga 20.000 Beli 5 gratis 1 - Info & Order Hubungi link yg di bio Selamat Berbelanja 😂😂 - - gelang gelangprusik gelangjangkar gelangkulit gelangmurah gelangcewe gelangcowo kalung kalungcowo accessories kadounik kadoultah pendaki pendakicantik pendakikeren anaksma hitspelajar exploreaceh exploresamarinda exploresurabaya exploremalang like4like follow4follow

37 Seconds ago
maria (maria777salim) Instagram Photos and Videos

maria

@maria777salim


Comment from maria:


mojokertomojokertomodifmojoker jokertocantiksurabayahitskedir kedirihitsmojokertomodifpacetk acetkotawisatabatucantikindomo ndomodelindonesiapendakicantik simpanglimagumulladiesbikersan ersanaksmaidanakhitsbidadarise ariselfieigohotasianhottanteke ntekekinianbangetanakkekinianh nianhappyweekendsmakekiniansma

47 Seconds ago
Pesonamu Inspirasi Dunia (id.gadis) Instagram Photos and Videos

Pesonamu Inspirasi Dunia

@id.gadis


Comment from Pesonamu Inspirasi Dunia:


Foto by : @ayuanita14 Selamat malam ________________________ @id.gadis dan selalu gunakan gadis untuk kami repost _______________________ __________________________ kal jogja bali instagram photooftheday l4l pendakicantik jakarta ugmcantik travel weekend dayak lfl jambi fff coment ayodolan travellercantik jalanjalan pictureoftheday keluarbentar gadis gadihminangkabau wanita

1 Minutes ago
 (pixel.traveller) Instagram Photos and Videos

pixel.traveller

@pixel.traveller


Comment from pixel.traveller:


We got the sunset 😘😘 ➖➖➖ 📷 Lovely Sunset Photo by @adrianhardo 📍 Loc : Gili Genting, Sumenep - Madura ➖➖➖ pixeltraveller

2 Minutes ago
Pesonamu Inspirasi Dunia (id.gadis) Instagram Photos and Videos

Pesonamu Inspirasi Dunia

@id.gadis


Comment from Pesonamu Inspirasi Dunia:


Foto by : @poppylestari05 Nih from palembang ____________________ _____________________________ @id.gadis dan selalu gunakan gadis untuk kami repost _______________________ __________________________ kal jogja bali instagram photooftheday l4l pendakicantik jakarta ugmcantik travel weekend dayak lfl jambi fff coment ayodolan travellercantik jalanjalan pictureoftheday keluarbentar gadis gadihminangkabau wanita

2 Minutes ago
Flor Handmade Project (flor.project) Instagram Photos and Videos

Flor Handmade Project

@flor.project


Comment from Flor Handmade Project:


3 Minutes ago
Fadia Nur Fitri (fadiafitri) Instagram Photos and Videos

Fadia Nur Fitri

@fadiafitri


Comment from Fadia Nur Fitri:


3 Minutes ago
Indah Setyaningsih (indahsetyaningsih92) Instagram Photos and Videos

Indah Setyaningsih

@indahsetyaningsih92


Comment from Indah Setyaningsih:


Gak niat metik kok cuma mau liat lebih deket ajah bunga yang katanya jadi simbol keabadian itu. .edelweis. idpendaki pendakicantik instagunung jelajahgunung parapejalan parapetualang

4 Minutes ago
 (nengolis_1878) Instagram Photos and Videos

nengolis_1878

@nengolis_1878


Comment from nengolis_1878:


Asa pengen ke sana lagih ! Yuhuuu @manchesterunited 🔴 mufcfans mufcfanpics mufc ggmu unitedtogether unitedfans unitedindonesia unitedindonesiatgr gunungpapandayan jawabarat garut pendaki pendakiindonesia pendakicantik naikgunung gorengpatut saayana baedaurang naonwe

9 Minutes ago
NurA_ziz (nurilncb) Instagram Photos and Videos

NurA_ziz

@nurilncb


Comment from NurA_ziz:


Peace...✌😉 wanitagunung mountains pendakiindonesia pendakicantik

9 Minutes ago
Defri_Secondoutdoor (defripranata) Instagram Photos and Videos

Defri_Secondoutdoor

@defripranata


Comment from Defri_Secondoutdoor:


MARREL TAPAK VIBRAM TAPAK GONDRONG SIZE 36 id line : defripranata84 WA : 085252774853 defrisecondoutdo berghaus jaketsecond jaketberghaus jualjaketrunning pendakicantikindonesia pendakian pendakicantik treveler treveller trevellerindonesia pendakicantik mountainrunning mountainindonesia jualjaketrunning jualtnfsecond mountainhardware mammut rab millet jualjaketmurah jualjaket jualjaketrunningadidas secondbrandedmurah secondbrandedjkt secondbrandedstuff

10 Minutes ago
Thoink Pinus (thoinkpinus) Instagram Photos and Videos

Thoink Pinus

@thoinkpinus


Comment from Thoink Pinus:


THE NORTH FACE VENTURE HYBRID JACKET SIZE XL MENS NEW & ORIGINAL WITH TAG WATERPROOF WINDPROOF BREATHABLE DRYVENT TECH BAHAN 2,5 LAYER SINGLE ZIP ADA ZIP KETIAK OUTER SAJA FIX HODDIE WARNA ASPHALT GREY BLACK SIZE XL MENS SANGAT COCOK UNTUK SUHU EXTREEM DI GUNUNG BAHAN NYAMAN DAN LEMBUT MRSP $149 IDR XL MENS 675.000 MASIH JAUH LEBIH MURAH 081284419609 SMS/WA THANKS FB : THOINKPINUS THANKS jualtheno jualjaketoriginal jalan2man jalanjalanmen jejakpendaki jejakpetualang id_petualang id_pendaki cantikpendaki travelercantik pesonagunung petualangcantik pendakicantik pendakiindonesia indonesiamountain instapendaki mytripmyadventure kedaipendaki kawantrip indonesiamountain instapendaki travelercantik mytrip_myadvntr mountainesia sahabatpendaki

10 Minutes ago
outletkaki5 (outlet_kaki5) Instagram Photos and Videos

outletkaki5

@outlet_kaki5


Comment from outletkaki5:


TAS KOPER TROLLY TRAVEL BAG POLO HOMME 01 @255rb VIA JNE BERAT KIRIM HANYA 2KG!! TAS KOPER POLO HOMME BAHAN : SEMI KULIT TEBAL UKURAN : 50x28x32CM KIRA2 SEUKURAN 20INCH RUANG: -UTAMA LUAS -DEPAN -BELAKANG ADA KANTONG KECIL ZIPER PEGANGAN TROLLY DAPAT DISEMBUNYIKAN SESUAI GAMBAR TANPA TALI PANJANG/SELEMPANG WARNA DAN MODEL SESUAI GAMBAR Sms/wa 081380987872 Line: outletkaki5 taskoperpolo taskoper tastrolly tastrollypolo jalanjalan mudik jakarta indonesia pendakigunung pendakicantik

11 Minutes ago
STRUGGLE OUTDOOR SYNDICATE (struggle_outdoor_syndicate) Instagram Photos and Videos

STRUGGLE OUTDOOR SYNDICATE

@struggle_outdoor_syndicate


Comment from STRUGGLE OUTDOOR SYNDICATE:


Geser 🔛 COLUMBIA GABLE PASS JACKET ● Size S fit M (P.74 x L.54) ● Omni-tech ● Waterproof ● Breathable ● New Info & order: 📩 WA/LINE: 083821221142 🔭 Status: READYSTOCK_SOS 🛩Jne - J&t / Bandung Cek testimoni: @atosoldout Grab it fast brother, limited edition!!! ------------------- ------------------------------ anda senang sampaikan pada teman]

11 Minutes ago
Indonesia Caricature (indonesia.caricature) Instagram Photos and Videos

Indonesia Caricature

@indonesia.caricature


Comment from Indonesia Caricature:


Merbabu memang bikin rindu. . . ➖➖➖➖➖➖➖➖➖➖➖ . Follo : @indonesia.caricature . ➖➖➖➖➖➖➖➖➖➖➖ . Instagood indomountain pendaki exploregunung gunung instapendaki gunung mountain dagelan SMA love mountainesia instagram mahasiswa id_pendaki indotravellers pendakicantik Pemalang Tegal brebes mahasiswa mountainesia _caricature bandung jakarta yogyakarta semarang medan

13 Minutes ago
Danny Erd (fuck_erd) Instagram Photos and Videos

Danny Erd

@fuck_erd


Comment from Danny Erd:


FOR SALE : • THE NORTH FACE JACKET • SIZE S (EURO) • SIZE M (LOCAL) P67XL51 • WATERPROOF • BREATHABLE • WINDPROOF • REMOVABLE HOODIE • SAKU BAHU • LENGAN VELCRO GOOD CONDITION DETAIL PICT : GESER KE KIRI 👈 PRICE : RP.➖( HUB.KONTAK ADMIN ) 🙏TIDAK MELAYANI DM 🙏 FOR SERIOUS BUYER : • CP/WA : 085724090613 • LINE : DANYERDPSB • IG : FUCK_ERD • FB : DANNY ERD PSB • COD : SUKABUMI JAWABARAT ______________________________ CHECK READY STOCK : erd_ready

14 Minutes ago
outdoor tangerang (outdoortangerang) Instagram Photos and Videos

outdoor tangerang

@outdoortangerang


Comment from outdoor tangerang:


Te en ep lokalan..size 38-42... Grosiran ya.. Anfad outdoor equipment Alamat. Jl.cadas- sepatan tangerang Wa 085692555321 Pin bb DA1811A3 anfadoutdoorequipmen tasgunungmurah tangerang hikeadventureoutlet headlamp outdoortangerang lapakpendaki lapakpendakigunungjamskmei alatoutdoormurah grosiralatoutdoor pendakiindonesia pendaki_id savenature mountbrand haosepatugunung tendamurah carriermurah quechua pendakicantikanfadoutdoor

17 Minutes ago
Defri_Secondoutdoor (defripranata) Instagram Photos and Videos

Defri_Secondoutdoor

@defripranata


Comment from Defri_Secondoutdoor:


readystokdso COLUMBIA SIZE 38 INSOLE 23.5 cm KUKIT KONDISI NOS 👍 📌Belum mandi Sikat bang 😁 MINAT : WA : 085252774853 ID LINE : defripranata84 defrisecondout berghaus jaketsecond jaketberghaus jualjaketrunning pendakicantikindonesia pendakian pendakicantik treveler treveller trevellerindonesia pendakicantik mountainrunning mountainindonesia jualjaketrunning jualtnfsecond mountainhardware mammut rab millet jualjaketmurah jualjaket jualjaketrunningadidas secondbrandedmurah secondbrandedjkt secondbrandedstuff

17 Minutes ago
Kedai_Outdoor_Lelong_Brandid (kedai_outdoor) Instagram Photos and Videos

Kedai_Outdoor_Lelong_Brandid

@kedai_outdoor


Comment from Kedai_Outdoor_Lelong_Brandid:


TREKSTA GORE-TEX SIZE 39 INSOL 24 IDR.........DM/WA TREKSTA SEPATUSECOND SEPATU TRAKKING PENDAKI PENDAKICANTIK PENDAKI PENDAKIMUSLIM PECINTAGUNUNG M UNG MAPALA MAPALAACEH JELAJAH

18 Minutes ago
Mia_monica26 (mia_monica26) Instagram Photos and Videos

Mia_monica26

@mia_monica26


Comment from Mia_monica26:


Yakin nih cuma mau diem di rumah aja. Ngga mau ngikut muncak 😀 📷 : @said_kadarsyahh 💋💝 🔎 : Jalur pendakian gn prau via patak banteng 🍃 🌏 : Wonosobo jawa Tengah Indonesia mountainesia pendakikusam indo.mountaineer id_pendaki pendakicantik pendakiindonesia pendaki_id ladiesmountain camerapendaki praumountain wonosobo

20 Minutes ago
Ipan (irfanhidayah1996) Instagram Photos and Videos

Ipan

@irfanhidayah1996


Comment from Ipan:


Senja adalah rasa yang bertahan, ketika matahari memilih untuk tenggelam. Sebelum akhirnya ditinggal sendirian tanpa cahaya, dalam gelap. . . . . 📍loc Alun - Alun Surya Kencana

20 Minutes ago
Pejalan Santai Pendaki 3L (wahyuphe) Instagram Photos and Videos

Pejalan Santai Pendaki 3L

@wahyuphe


Comment from Pejalan Santai Pendaki 3L:


Tutorial membuat kompor lapangan dari kaleng. Jadi rindu bikin kompor lapangan pake kaleng ✌✌ Sekarang lebih sering pake kompor gas portable sih pas pendakian, selain lebih cepat panas, bahan bakarnya juga ga akan tumpah kayak spirtus. Namun pada beberapa kondisi ketika berada di ketinggian dengan tekanan udara yang kecil, terkadang nyala gas tidak stabil dan bisa jadi mampet. Untuk menghindari hal tersebut, beberapa senior menyarankan untuk membawa kompor lapangan spirtus ini. . Keunggulan kompor lapangan seperti ini adalah : -Murah, karena membuat sendiri, bahkan tanpa lem -Ringan dan ukurannya kecil. -Lebih seru untuk dijadikan penghangat ketika malam hari di luar tenda. (Pernah seminggu pake beginian) -Nyala besar . Kekurangan kompor lapangan seperti ini adalah: -Tidak bisa diisi ulang hingga spirtusnya dihabiskan terlebih dahulu. -Tidak bisa digunakan di dalam tenda, sangat bersiko ketika tidak sengaja tumpah. -Tidak bisa mengatur besaran nyala api yang keluar. Tapi di beberapa tempat, memang spirtus sudah dilarang, alasannya karna dapat menimbulkan kebakaran, dan tentu saja ada alasan lainnya. Coba deh, seru kok... Share dong yg pernah pake ginian jg. NB: itu tengahnya (yg disuntik) bs jg langsung dilubangin gede yaa, gk sekecil ituu . . Seminggu masak pake beginian jadi rinduu 😌😌 . . Picture by: @kreatips Info by: pengalaman pribadi+berbagai sumber

21 Minutes ago
mairezi rahmitasari (mairezirahmitasari) Instagram Photos and Videos

mairezi rahmitasari

@mairezirahmitasari


Comment from mairezi rahmitasari:


Aku kamu dan Slamet Loc: Mt. Slamet pendakicouple pendakiindonesia wanitakuat wanitagunung pendakicantik pendakikusam pesonaindonesia mountainesia mountains id_pendaki pendakibaper piknikkegunung

22 Minutes ago
kakitanganalam.id (kakitanganalam) Instagram Photos and Videos

kakitanganalam.id

@kakitanganalam


Comment from kakitanganalam.id:


Mentari meredup bukan berarti dia akan mengingkari janjinya untuk terbut di ufuk timur besok, selayaknya hati yang berjanji takkan mudah mengingkari dengan mudah seperti membalik telapak tangan. Happy satnight gaess. . . . @upikmnr . . . kakitanganalam mountains_indonesia pendaki_hati_beriman mountain_story mountnesia kabut_lembut indonesia_photography instamdpl indo_hikers ind indonesia pendakibackpacker pendakicantik pendakiindonesia onlineshopindonesia instamdpl mountainleader folk folkindonesia baturmountain . . . Go follow @kakitanganalam @mountains_indonesia @pendaki_hati_beriman

23 Minutes ago
Gevan Dwi Tira (gevandwi) Instagram Photos and Videos

Gevan Dwi Tira

@gevandwi


Comment from Gevan Dwi Tira:


MONTPIC EXTREME TECNHICAL OUTDOOR Waterproof Windproof I polar Size xl Panjang x lebar 72x56 Kondisi 95% Harga? DM explorejawabarat jaketsecond jaketoutdoorsecond jaketgunung jaketbekas blackyak merrel thenorthface montbell mountainhardwear explorebandung jaketgunungbekas instamdpl pendakiikhlas snowboardbekas pendakicantik pendakiindonesia pendakisantai ranukumbolo mahameru merapi merbabu sumbing sindoro jaketoutdoor instagood idpendaki lowealpine jaketsnowboard pendakisantai fjallraven

23 Minutes ago
nurmaya (juminten.27) Instagram Photos and Videos

nurmaya

@juminten.27


Comment from nurmaya:


Kamu gak perlu menjauh, aku bisa berjalan mundur. 👣 . . . *happy satnite mblo 😊 (lanjut bobok) 📍3371mdpl exploremdpl explorjawatengah pendakingalem pendakilemah pendakiindonesia pendakicantik cewekgunung bukancewekhitz mountaineer

25 Minutes ago
Tentang program kehamilan (tentang.program.kehamilan) Instagram Photos and Videos

Tentang program kehamilan

@tentang.program.kehamilan


Comment from Tentang program kehamilan:


Bunda itu testimoni dari pasien kami yang allhamdulillh telah berhasil bunda..Semoga dengan tetimoni itu bisa menjdi motivasi bunda agar bisa segera menyusul bunda kami yang telah berhasil asalkan bunda ingin dan rutin mengikuti anjuran dari saya selama terapinya nanti bunda.. dan semoga bunda dan suami bisa menjdi testimoni kami selanjutnya bunda..🙂 "BUNDA INI HAMPIR SAJA PUTUS ASA. TAPI BERKAT DOA DAN IKHTIARNYA. DAN TETAP KONSUMSI HERBAL BEE. ALLAHUAKBAR. ATAS IJIN ALLAH BELIAU BISA HAMIL. " SUBHANALLAH.

25 Minutes ago
KAIN TENUN NUSANTARA (tenunaskara) Instagram Photos and Videos

KAIN TENUN NUSANTARA

@tenunaskara


Comment from KAIN TENUN NUSANTARA:


Beautiful black. Blanket tenun. 100% ATBM. Only 155K, 5% donation. 💚 Salam damai !

25 Minutes ago
Indo Mountaineer (indo.mountaineer) Instagram Photos and Videos

Indo Mountaineer

@indo.mountaineer


Comment from Indo Mountaineer:


📍Photo by @itsmeagoy Moal butuh loba ari jadi cacing hungkul mah. Mending hiji tapi oray kobra 📍Tag @indo.mountaineer and Hashtag your moment mountaineer

25 Minutes ago
KAIN TENUN NUSANTARA (tenunaskara) Instagram Photos and Videos

KAIN TENUN NUSANTARA

@tenunaskara


Comment from KAIN TENUN NUSANTARA:


Still available .Blanket tenun motif sumba. 100% ATBM. Only 150K, 5% donation. 💚 Salam damai !

27 Minutes ago
KAIN TENUN NUSANTARA (tenunaskara) Instagram Photos and Videos

KAIN TENUN NUSANTARA

@tenunaskara


Comment from KAIN TENUN NUSANTARA:


Best seller. Blanket tenun. 100% ATBM. Only 145K, 5% donation. 💚 Salam damai !

29 Minutes ago
KAIN TENUN NUSANTARA (tenunaskara) Instagram Photos and Videos

KAIN TENUN NUSANTARA

@tenunaskara


Comment from KAIN TENUN NUSANTARA:


Blanket tenun. 100% ATBM. Only 145K, 5% donation. 💚 Salam damai !

30 Minutes ago