Search Tagsfor tasimport

ayutingting raffinagita joyagh (walletbagstuff) Instagram Photos and Videos

ayutingting raffinagita joyagh

@walletbagstuff


Comment from ayutingting raffinagita joyagh:


. 👉🏻 ORDER ? WAJIB KIRIM FORMAT LENGKAP YAH ! Kirim format lengkap nya yah kak sekali enter (jangan terpisah2) Biar bisa ditotalin dengan benar 😁👍🏻 Nama penerima : Alamat lengkap (kec+kab) : No hp : Nama brg + warna : . Jika dropship tulis nama pengirim nya ya . Diisi sekali enter kirim ke kita yah kak WA 085876518091 HARGA BELUM ONGKIR DR JAKARTA INFO ORDER CHAT READY & REALPICT ORDER ? KIRIM FORMAT LENGKAP NAMA : ALAMAT LNGKAP : NO HP : NAMA BARANG+WARNA: Line ke @KEB1129Q (pakai @) pembelian melalui line add get voucher 10rb untuk pembelian selanjutnya^^ suppliertastasjakartajakartaolshopreadystockrealpicthiqhqualitytasbrandedtasmurahtashitsolshopidsuppliertasbrandedtaskatespadetaschanneltashermeswalletbagstuffsyahriniincessbagmurmertasfurlatasfenditaspradatascelinetasgivenchytasimportjualanka grosirantaskonveksitascaritascaritasmurahtassyahrini.

1 Minutes ago
PUSAT GROSIR TAS MURAH (perfectcornerhengki) Instagram Photos and Videos

PUSAT GROSIR TAS MURAH

@perfectcornerhengki


Comment from PUSAT GROSIR TAS MURAH:


Reseller and Dropshipper Welcome :) Contact : BBM : 596665A2 LINE : @rvj6337h WA : 0895-3185-4895 PCA2527 Navy Bahan :PU Size :32x14x21 (20x7.5x12) 1.30Kg IDR 210.000 grosirtas grosirtasmurah tas suppliertas taskorea supplierterbesar tasbatam grosirtasbatam tasbatammurah tasmurah reseller dropship suppliertasbatam tasimportmurah tasimport perfectcorner suppliertasmurah grosir bisnis

1 Minutes ago
*StarFashion* (agen_tas_import_batam_murah) Instagram Photos and Videos

*StarFashion*

@agen_tas_import_batam_murah


Comment from *StarFashion*:


Eceran 140.000 Reseller 130.000 Cek juga koleksi kita di www.Starfashion.click . Tas Fashion IMPORT from Hongkong Taiwan. Pengiriman barang from Batam . Tanya2 & Order WA : 0812 667 6668 BBM : D075E335 Line : TOP_FASHION_BAG Line : @zum5766i . 🍀Harga belum termasuk ongkir 🍀Pengiriman via JNE 🍀Resi H+2hr 🍀Reseller very welcome . tas tasimportbatam tasimportmurah tasimport tasmurah tasgrosir tascewek tasmurmer tasimportkorea tasfashion taskorea tasbatam grosir grosirtas agentas pusatgrosir pusattas handbag

1 Minutes ago
PUSAT GROSIR TAS MURAH (perfectcornerhengki) Instagram Photos and Videos

PUSAT GROSIR TAS MURAH

@perfectcornerhengki


Comment from PUSAT GROSIR TAS MURAH:


Reseller and Dropshipper Welcome :) Contact : BBM : 596665A2 LINE : @rvj6337h WA : 0895-3185-4895 PCA2527 Brown Bahan :PU Size :32x14x21 (20x7.5x12) 1.30Kg IDR 210.000 grosirtas grosirtasmurah tas suppliertas taskorea supplierterbesar tasbatam grosirtasbatam tasbatammurah tasmurah reseller dropship suppliertasbatam tasimportmurah tasimport perfectcorner suppliertasmurah grosir bisnis

1 Minutes ago
Fashion, Hijabs & Tas Batam 😘 (wmfshoppy01) Instagram Photos and Videos

Fashion, Hijabs & Tas Batam 😘

@wmfshoppy01


Comment from Fashion, Hijabs & Tas Batam 😘:


Outer Jaring @65k -------_---------_----------------_------------👇👇 Kontak/hubungi (pilih salah satu/Fast Respon) BBM: D584F534 WA: 085239153328 Line: bqwmf --happy shopping-- baju dress gamis cardigan jualbaju jualsepatu jualtas grosirbaju fashion blouse top likefollow likeback kebaya flower bajumurah couple gamismurah hijabhijab fashion ladyfashion jualbaju jualhijab jualtas tasimport bajubaju outerjaring

1 Minutes ago
Grosir Fashion Import (myberrychic) Instagram Photos and Videos

Grosir Fashion Import

@myberrychic


Comment from Grosir Fashion Import:


IDR.166.000 Material : Polyamide canvas Height : 42cm Length : 32cm Depth : 13cm Bag Mouth : Zipper Weight : 900gram 1Sthandbag 1sthandimport tasmurah tasimport bagcollection bagimport bagkorea bagolshop bagshop belanjaonline belanjatasberkualitas bestseller branded brandedbag brandedbagmurahbrandedmurah brandedreplica carireseller cewek cewekcantik dagangan suppliertas tasbatam jualtasimport jualtasmurah tasimport tasimportmurah tasbangkok tasbkk

1 Minutes ago
TAS BRANDED ORIGINAL & REPLIKA (beautyniceos) Instagram Photos and Videos

TAS BRANDED ORIGINAL & REPLIKA

@beautyniceos


Comment from TAS BRANDED ORIGINAL & REPLIKA:


Paris Hilton Hikin Premium Harga 260rb Ukuran 26x27 Bahan Kulit Embos Order Whatsapp 083819942804 tasbatamtasbatammurahtasimporttasimportmurahtasfashiontasfashionmurahtasfashionwanitatascewetascewektaswanitasuppliertassuppliertasmurahsuppliertascewektasranseltasslempangtasmurahbajucewekbajumurahbeautynice

1 Minutes ago
TAS IMPORT FREE ONGKIR (afrissada) Instagram Photos and Videos

TAS IMPORT FREE ONGKIR

@afrissada


Comment from TAS IMPORT FREE ONGKIR:


Real pict yess.. Import tapi murah ya kakak testimoni freeongkirseluruhindonesia tasimport tasbranded tasbatam tasbangkok

2 Minutes ago
TAS BRANDED ORIGINAL & REPLIKA (beautyniceos) Instagram Photos and Videos

TAS BRANDED ORIGINAL & REPLIKA

@beautyniceos


Comment from TAS BRANDED ORIGINAL & REPLIKA:


Paris Hilton Hikin Premium Harga 260rb Ukuran 26x27 Bahan Kulit Embos Order Whatsapp 083819942804 tasbatamtasbatammurahtasimporttasimportmurahtasfashiontasfashionmurahtasfashionwanitatascewetascewektaswanitasuppliertassuppliertasmurahsuppliertascewektasranseltasslempangtasmurahbajucewekbajumurahbeautynice

2 Minutes ago
TAS BRANDED ORIGINAL & REPLIKA (beautyniceos) Instagram Photos and Videos

TAS BRANDED ORIGINAL & REPLIKA

@beautyniceos


Comment from TAS BRANDED ORIGINAL & REPLIKA:


Paris Hilton Hikin Premium Harga 260rb Ukuran 26x27 Bahan Kulit Embos Order Whatsapp 083819942804 tasbatamtasbatammurahtasimporttasimportmurahtasfashiontasfashionmurahtasfashionwanitatascewetascewektaswanitasuppliertassuppliertasmurahsuppliertascewektasranseltasslempangtasmurahbajucewekbajumurahbeautynice

2 Minutes ago
GROSIR TAS MURAH (tashumaira_grosir_jakarta) Instagram Photos and Videos

GROSIR TAS MURAH

@tashumaira_grosir_jakarta


Comment from GROSIR TAS MURAH:


Barang baru, * HARGA : 195000 * KODE : KNC-B1012 * KODE TAG & WARNA : KOSMETIK - MERAH * NAMA : KNC KOSMETIK ROCKSTAR GESPER SET DOMPET+GANTUNGAN * UKURAN : 19X10X18, DOMPET 10X5X7 * BERAT : 0.75 * KUALITAS : SUPER * KETERANGAN : WARNA : HITAM 1011 MERAH 1012 PINK F 1013 BIRU D 1014 KHAKI 1015 LIME 1016 SALEM 1017 - SET TAS+DOMPET OVAL BAHAN KULIT TAIGA, BAHAN DALAMAN KULIT - FREE GANTUNGAN TAS TUTUP DALAMNYA CATNYA AGAK TERBUKA SEDIKIT. TIDAK DIANGGAP RETUR KARNA PENGERJAANNYA HANDMADE AGAK SULIT YA SAI ADA TALI PANJANG UNTUK SLEMPANG RESLETING ADA (DALAMAN), BUKAAN BEHEL SLOT PAKAI SERTIFIKAT JIKA PERSEDIAAN MASIH ADA - GRAB IT FAST SISTA! CANTIK BANGET Grosirjam GrosirTasBranded Tasbranded GrosirTasMurah TasGrosir KulakanTas JamTangan TasImport JamCewek GrosirTas TasMurah jam grosir Tas DropshipTas TasPesta ResellerTas JuraganTas

2 Minutes ago
Sepatu,Tas FREE ONGKIR (nirmalaashop) Instagram Photos and Videos

Sepatu,Tas FREE ONGKIR

@nirmalaashop


Comment from Sepatu,Tas FREE ONGKIR:


Kode INK BTH740 Material PU Size 23x20x15 cm 600gr Harga 158k Free Ongkir tas tasmurah tasmurmer tasbandung tasjakarta tasmedan tasbatam tasmalang tassurabaya tasimport

2 Minutes ago
Nanda Collection (nandcollection) Instagram Photos and Videos

Nanda Collection

@nandcollection


Comment from Nanda Collection:


SALE Rp 220.000 Ransel MCM 8860 Ukr 31x16x30 Bahan Kulit Jeruk Kualitas Super ➡Orange ➡Apricot ➡Blue ➡Black FREE ONGKIR area Pontianak ya🙂 . . . . tasbatam tasimport tasbatamimport tasbatammurah tasbatambranded

2 Minutes ago
👜 TAS BRANDED MURAH (feby.bags) Instagram Photos and Videos

👜 TAS BRANDED MURAH

@feby.bags


Comment from 👜 TAS BRANDED MURAH:


Best seller langsung di sale lagi Dijamin termurah 🌺 Ks minka 🌺 Harga 185.000 saja/pcs 🌺 Size 45x25x14 🌺 Bahan : kulit jeruk import (tebel kokoh lemes) Kualitas bahannya bagus banget tebel dan lemes 😘 Cocok banget buat bawa ke kantor loh guys 😍 Karna ukurannya yg gede dan model nya yg keren Ada tali panjang dan tali pendek nya +dustbag Pompom+15rb . . Minat ? atau mau tanya-tanya dulu bisa hubungi kontak di bio ya say 😘 . . onlineshop olshop olshopmurah olshopjakarta jualtas jualtasbranded jualtasmurah jualtasfashion jualtasreplika jualmurah trusted trustedolshop trustedseller onlineshopjakarta onlineshoppalembang jualslingbag clutch dompet jualclutchmurah jualdompetmurah tasbranded tasmurah tasmurahjakarta tasfashion tasimport jualtasimport

2 Minutes ago
 (mixnmaxshop) Instagram Photos and Videos

mixnmaxshop

@mixnmaxshop


Comment from mixnmaxshop:


Swipe untuk melihat warna/ motif >> Satuan @55.000 Seri @35.000

2 Minutes ago
GROSIR TAS BANDUNG (lv_galeri1) Instagram Photos and Videos

GROSIR TAS BANDUNG

@lv_galeri1


Comment from GROSIR TAS BANDUNG:


Kemiripan gambar 90% harga satuan @72000 harga reseller @66000 harga grosir @64000 Mau tanya tanya dan order : wa : 085872164763 line : lv_id Follow juga ig kita yang lain. @lv_galeri1 (grosir tas) @lv_galeri2 (grosir dompet) @bukubisnis_lvbookstore (buku bisnis @annie_lavin (ig pribadi) - - - tasbranded tas jualtas tasimport jualtasmurah onlineshop tascewek jualantas tasbrandedmurah tasbatam sepatumurah bajumurah suppliertas tascantik dompetmurah taswanita bag grosirtas trustedseller taslucu olshop jualanku tasimportmurah slingbag tasfashion dompet tasransel trustedolshop jualan taskorea

2 Minutes ago
👜 TAS BRANDED MURAH (feby.bags) Instagram Photos and Videos

👜 TAS BRANDED MURAH

@feby.bags


Comment from 👜 TAS BRANDED MURAH:


Best seller langsung di sale lagi Dijamin termurah 🌺 Ks minka 🌺 Harga 185.000 saja/pcs 🌺 Size 45x25x14 🌺 Bahan : kulit jeruk import (tebel kokoh lemes) Kualitas bahannya bagus banget tebel dan lemes 😘 Cocok banget buat bawa ke kantor loh guys 😍 Karna ukurannya yg gede dan model nya yg keren Ada tali panjang dan tali pendek nya +dustbag Pompom+15rb . . Minat ? atau mau tanya-tanya dulu bisa hubungi kontak di bio ya say 😘 . . onlineshop olshop olshopmurah olshopjakarta jualtas jualtasbranded jualtasmurah jualtasfashion jualtasreplika jualmurah trusted trustedolshop trustedseller onlineshopjakarta onlineshoppalembang jualslingbag clutch dompet jualclutchmurah jualdompetmurah tasbranded tasmurah tasmurahjakarta tasfashion tasimport jualtasimport

2 Minutes ago
👜 TAS BRANDED MURAH (feby.bags) Instagram Photos and Videos

👜 TAS BRANDED MURAH

@feby.bags


Comment from 👜 TAS BRANDED MURAH:


Best seller langsung di sale lagi Dijamin termurah 🌺 Ks minka 🌺 Harga 185.000 saja/pcs 🌺 Size 45x25x14 🌺 Bahan : kulit jeruk import (tebel kokoh lemes) Kualitas bahannya bagus banget tebel dan lemes 😘 Cocok banget buat bawa ke kantor loh guys 😍 Karna ukurannya yg gede dan model nya yg keren Ada tali panjang dan tali pendek nya +dustbag Pompom+15rb . . Minat ? atau mau tanya-tanya dulu bisa hubungi kontak di bio ya say 😘 . . onlineshop olshop olshopmurah olshopjakarta jualtas jualtasbranded jualtasmurah jualtasfashion jualtasreplika jualmurah trusted trustedolshop trustedseller onlineshopjakarta onlineshoppalembang jualslingbag clutch dompet jualclutchmurah jualdompetmurah tasbranded tasmurah tasmurahjakarta tasfashion tasimport jualtasimport

3 Minutes ago
TAS IMPORT FREE ONGKIR (afrissada) Instagram Photos and Videos

TAS IMPORT FREE ONGKIR

@afrissada


Comment from TAS IMPORT FREE ONGKIR:


Mini handbag yahh testimoni freeongkirseluruhindonesia tasbranded tasbangkok tasimport tasbatam

3 Minutes ago
Gudang Tas Import Batam (brandedbatam_shop) Instagram Photos and Videos

Gudang Tas Import Batam

@brandedbatam_shop


Comment from Gudang Tas Import Batam:


H E R M E S Birkin Luminous. Series 02MH1068. Reseller Price IDR 310.000,- Measurement Base 30cm. Height 22cm. Material Faux Croco leather. Semipremium Quality. . bag bagimport tas taskerja tasbatam taswanita tasimport tasbranded tasfashion taspremium taskuliah tashermes tasbatammurah tasbrandedbatam hermesbag hermesbirkin birkinluminous birkin hermes

3 Minutes ago
👜 TAS BRANDED MURAH (feby.bags) Instagram Photos and Videos

👜 TAS BRANDED MURAH

@feby.bags


Comment from 👜 TAS BRANDED MURAH:


Best seller langsung di sale lagi Dijamin termurah 🌺 Ks minka 🌺 Harga 185.000 saja/pcs 🌺 Size 45x25x14 🌺 Bahan : kulit jeruk import (tebel kokoh lemes) Kualitas bahannya bagus banget tebel dan lemes 😘 Cocok banget buat bawa ke kantor loh guys 😍 Karna ukurannya yg gede dan model nya yg keren Ada tali panjang dan tali pendek nya +dustbag Pompom+15rb . . Minat ? atau mau tanya-tanya dulu bisa hubungi kontak di bio ya say 😘 . . onlineshop olshop olshopmurah olshopjakarta jualtas jualtasbranded jualtasmurah jualtasfashion jualtasreplika jualmurah trusted trustedolshop trustedseller onlineshopjakarta onlineshoppalembang jualslingbag clutch dompet jualclutchmurah jualdompetmurah tasbranded tasmurah tasmurahjakarta tasfashion tasimport jualtasimport

3 Minutes ago
👜 TAS BRANDED MURAH (feby.bags) Instagram Photos and Videos

👜 TAS BRANDED MURAH

@feby.bags


Comment from 👜 TAS BRANDED MURAH:


Best seller langsung di sale lagi Dijamin termurah 🌺 Ks minka 🌺 Harga 185.000 saja/pcs 🌺 Size 45x25x14 🌺 Bahan : kulit jeruk import (tebel kokoh lemes) Kualitas bahannya bagus banget tebel dan lemes 😘 Cocok banget buat bawa ke kantor loh guys 😍 Karna ukurannya yg gede dan model nya yg keren Ada tali panjang dan tali pendek nya +dustbag Pompom+15rb . . Minat ? atau mau tanya-tanya dulu bisa hubungi kontak di bio ya say 😘 . . onlineshop olshop olshopmurah olshopjakarta jualtas jualtasbranded jualtasmurah jualtasfashion jualtasreplika jualmurah trusted trustedolshop trustedseller onlineshopjakarta onlineshoppalembang jualslingbag clutch dompet jualclutchmurah jualdompetmurah tasbranded tasmurah tasmurahjakarta tasfashion tasimport jualtasimport

3 Minutes ago
 (mixnmaxshop) Instagram Photos and Videos

mixnmaxshop

@mixnmaxshop


Comment from mixnmaxshop:


Swipe untuk melihat warna/ motif >> Satuan @90.000 Seri @70.000

3 Minutes ago
ayutingting raffinagita joyagh (walletbagstuff) Instagram Photos and Videos

ayutingting raffinagita joyagh

@walletbagstuff


Comment from ayutingting raffinagita joyagh:


. 👉🏻 ORDER ? WAJIB KIRIM FORMAT LENGKAP YAH ! Kirim format lengkap nya yah kak sekali enter (jangan terpisah2) Biar bisa ditotalin dengan benar 😁👍🏻 Nama penerima : Alamat lengkap (kec+kab) : No hp : Nama brg + warna : . Jika dropship tulis nama pengirim nya ya . Diisi sekali enter kirim ke kita yah kak WA 085876518091 HARGA BELUM ONGKIR DR JAKARTA INFO ORDER CHAT READY & REALPICT ORDER ? KIRIM FORMAT LENGKAP NAMA : ALAMAT LNGKAP : NO HP : NAMA BARANG+WARNA: Line ke @KEB1129Q (pakai @) pembelian melalui line add get voucher 10rb untuk pembelian selanjutnya^^ suppliertastasjakartajakartaolshopreadystockrealpicthiqhqualitytasbrandedtasmurahtashitsolshopidsuppliertasbrandedtaskatespadetaschanneltashermeswalletbagstuffsyahriniincessbagmurmertasfurlatasfenditaspradatascelinetasgivenchytasimportjualanka grosirantaskonveksitascaritascaritasmurahtassyahrini.

3 Minutes ago
FOLLOW juga » @aslamode_outfit (aslamode) Instagram Photos and Videos

FOLLOW juga » @aslamode_outfit

@aslamode


Comment from FOLLOW juga » @aslamode_outfit:


FASHION BAG KODE : B2037 Color Black~Gray~Red Material PU Size : 32*24*11 Weight 0.9 PRICE : Rp. 175,000 Serius Order, Cantumkan format order ; » Nama Lengkap » Alamat Lengkap & jelas (tidak di singkat) » No. Telp yg bisa dihubungi » Kode Barang & Warna Kirim Melalui : WA : 085695454472 BBM : 7F90DB32 LINE : aslamode taslucu tascantik tasmurah tasmurahmeriah taskuliah highlyrecommended taskeren onlineshop tasimport aslamode tascewe taswanita tasperempuan tas tasreplika tasmodern taskekinian

3 Minutes ago
TAS IMPORT FREE ONGKIR (afrissada) Instagram Photos and Videos

TAS IMPORT FREE ONGKIR

@afrissada


Comment from TAS IMPORT FREE ONGKIR:


Mini backpack 😍 testimoni freeongkirseluruhindonesia tasbranded tasbangkok tasimport tasbangkok tasbatam

3 Minutes ago
Suzie A Hartanto (zieannie) Instagram Photos and Videos

Suzie A Hartanto

@zieannie


Comment from Suzie A Hartanto:


RESTOK!! Most Populer Bag In Japan! Anello Bag Multifungsi Seprem 210rb (UNISEX) 27x19x37 Bahan Kanvas Tebal Beige/Blue Beige/Blue/Red Beige/Red Beige/Red/Blue Blue Red Yellow Dalaman Kain . . taswanita tascewek tasimport tasbranded taschanel tasemory taslv tasgucci tasmk tasvictoriabeckam tasvalentino tasbotega taschloe tascoach tasparishilton tasfendi tasfashion tasemory taspremium tasset tassemipremium jualtaswanita jualtascewek jualtasbranded jualtasimport jualtasmini jualtaskekinian jualtaschanel jualtasemory tasanello jualtasanello

3 Minutes ago
Fast Respon_WA : 081286502825 (my_angelolshop_cccm76) Instagram Photos and Videos

Fast Respon_WA : 081286502825

@my_angelolshop_cccm76


Comment from Fast Respon_WA : 081286502825:


330rb Yang Di Tunggu~Tunggu...❤❤❤ NEW COLLECTION... NEW KEY CHAIN... NEW MY FOSSIL... ❤❤❤ Ready Stock New Arrival FOSSIL Sydney Satchel Multi Grey Set sz 26x20x13cm Pouch sz 20x15cm 302-1 QUALITY SEMI PLATINUM 1:1 (Berdasarkan ORIGINAL) ONLY 1 COLOURS MATERIAL: Clemence Leather INCLUDE: Key Chain, Longstrap,Pouch, Dustbag BERAT: 1 KG BestSeller FOSSIL in Outlet!!! SUDAH TERJAMINNN fossil fossiltas tasimport tasbranded

3 Minutes ago
 (mixnmaxshop) Instagram Photos and Videos

mixnmaxshop

@mixnmaxshop


Comment from mixnmaxshop:


Swipe untuk melihat warna/ motif >> Satuan @115.000 Seri @95.000

4 Minutes ago
👜 TAS BRANDED MURAH (feby.bags) Instagram Photos and Videos

👜 TAS BRANDED MURAH

@feby.bags


Comment from 👜 TAS BRANDED MURAH:


Best seller langsung di sale lagi Dijamin termurah 🌺 Ks minka 🌺 Harga 185.000 saja/pcs 🌺 Size 45x25x14 🌺 Bahan : kulit jeruk import (tebel kokoh lemes) Kualitas bahannya bagus banget tebel dan lemes 😘 Cocok banget buat bawa ke kantor loh guys 😍 Karna ukurannya yg gede dan model nya yg keren Ada tali panjang dan tali pendek nya +dustbag Pompom+15rb . . Minat ? atau mau tanya-tanya dulu bisa hubungi kontak di bio ya say 😘 . . onlineshop olshop olshopmurah olshopjakarta jualtas jualtasbranded jualtasmurah jualtasfashion jualtasreplika jualmurah trusted trustedolshop trustedseller onlineshopjakarta onlineshoppalembang jualslingbag clutch dompet jualclutchmurah jualdompetmurah tasbranded tasmurah tasmurahjakarta tasfashion tasimport jualtasimport

4 Minutes ago
Tas Murah Batam (tasfashion.indo) Instagram Photos and Videos

Tas Murah Batam

@tasfashion.indo


Comment from Tas Murah Batam:


IDR 166.000 . Tas Fashion IMPORT Hongkong Pengiriman barang from Batam . Order🔽 WA: 0856 258 9828 BBM: 5BEF6A99 Line: @tks4535a (link di bio) . 🔹Transfer sebelum jam 1 siang dikirim besok pagi 🔹Transfer setelah jam 1 siang dikirim lusa pagi 🔹Resi sehari setelah pengiriman 🔸Reseller / Dropshipper WELCOME . tas tasfashion tasimport tasimpor tasbranded tasmurah tasbatam taswanita taswanitamurah tasfashionmurah tasbatambranded suppliertas suppliertasfashion suppliertasimport suppliertasmurah suppliertasbatam batam ootd jualtasfashion jualtasimport jualtasbranded jualtasmurah jualtasbatam

4 Minutes ago
 (mixnmaxshop) Instagram Photos and Videos

mixnmaxshop

@mixnmaxshop


Comment from mixnmaxshop:


Swipe untuk melihat warna/ motif >> Satuan @115.000 Seri @95.000

4 Minutes ago
GROSIR TAS BANDUNG (lv_galeri1) Instagram Photos and Videos

GROSIR TAS BANDUNG

@lv_galeri1


Comment from GROSIR TAS BANDUNG:


Kemiripan gambar 90% harga satuan @72000 harga reseller @66000 harga grosir @64000 Mau tanya tanya dan order : wa : 085872164763 line : lv_id Follow juga ig kita yang lain. @lv_galeri1 (grosir tas) @lv_galeri2 (grosir dompet) @bukubisnis_lvbookstore (buku bisnis @annie_lavin (ig pribadi) - - - tasbranded tas jualtas tasimport jualtasmurah onlineshop tascewek jualantas tasbrandedmurah tasbatam sepatumurah bajumurah suppliertas tascantik dompetmurah taswanita bag grosirtas trustedseller taslucu olshop jualanku tasimportmurah slingbag tasfashion dompet tasransel trustedolshop jualan taskorea

4 Minutes ago