Search Tagsfor tasmurah

free ongkir via app shopee (galeri_1406_new) Instagram Photos and Videos

free ongkir via app shopee

@galeri_1406_new


Comment from free ongkir via app shopee:


@60 . REPLIKA . KEMIRIPAN 80-90% . tas tasmurah jualtas taswanita tasselempang ootd ootdindo fashion fashionwanita gudangtas jualantas suppliertas reseller resellerwelcome freeongkir onlineshopbandung slingbag ransel

1 Minutes ago
Maradhia_Shop (maradhia_shop) Instagram Photos and Videos

Maradhia_Shop

@maradhia_shop


Comment from Maradhia_Shop:


💖ARIANA AMOUR bahan cvas jahitan rapi ukuran 23x27 tali bisa diatur good quality under 50k💋 tasmurah taskece tascewek taskekinian tasmurahsurabaya happyshopping maradhiashop

1 Minutes ago
ayutingting raffinagita joyagh (walletbagstuff) Instagram Photos and Videos

ayutingting raffinagita joyagh

@walletbagstuff


Comment from ayutingting raffinagita joyagh:


. 👉🏻 ORDER ? WAJIB KIRIM FORMAT LENGKAP YAH ! Kirim format lengkap nya yah kak sekali enter (jangan terpisah2) Biar bisa ditotalin dengan benar 😁👍🏻 Nama penerima : Alamat lengkap (kec+kab) : No hp : Nama brg + warna : . Jika dropship tulis nama pengirim nya ya . Diisi sekali enter kirim ke kita yah kak WA 085876518091 HARGA BELUM ONGKIR DR JAKARTA INFO ORDER CHAT READY & REALPICT ORDER ? KIRIM FORMAT LENGKAP NAMA : ALAMAT LNGKAP : NO HP : NAMA BARANG+WARNA: Line ke @KEB1129Q (pakai @) pembelian melalui line add get voucher 10rb untuk pembelian selanjutnya^^ suppliertastasjakartajakartaolshopreadystockrealpicthiqhqualitytasbrandedtasmurahtashitsolshopidsuppliertasbrandedtaskatespadetaschanneltashermeswalletbagstuffsyahriniincessbagmurmertasfurlatasfenditaspradatascelinetasgivenchytasimportjualanka grosirantaskonveksitascaritascaritasmurahtassyahrini.

1 Minutes ago
💐Terapy Alamiah💐 (terapy_bioentherapy_energy) Instagram Photos and Videos

💐Terapy Alamiah💐

@terapy_bioentherapy_energy


Comment from 💐Terapy Alamiah💐:


Proses kehamilan itu keajaiban Tuhan , dianugerahkan hanya kepada mereka yang di kehendakinya, ada ribuan cara Tuhan dalam menjawab doa doa kita untuk mendapatkan keturunan.... sebagian dari kita di berikan petunjuk dan di gerakkan hatinya , sebagian lagi di berikan petunjuk namun tidak di gerakkan hatinya dan bahkan ada yang sama sekali tidak di berikan petunjuk dan tidak di gerakan hatinya... Tidak ada satu halpun yang terjadi secara kebetulan, semuanya akan melalui proses dan tahapan atas usaha yang di lakukan ketika kita menggapai anugerahnya ... Jangan hanya menunggu keajaiban dan berkutat dengan pertanyaan kapan dia ada dalam rahimku ? Untuk konsultasi masalah kehamilan, yuk segera hubungi kami disini 👇👇👇 BBM: D58B088B WA: 083833130379 Line: solusi_hamil_sehat19 kosmetikmurah skincaremurah glutapanaceamurah glutapanceaori serum fleecyscrub sepatucewek flatshoesmurah selebgram jamtanganmurah panceafiber hijabmurah maskernaturgo pinkonveksi tasmurah slingbagmurah panaceaslim glutainfinity raffiahmad jalanjalan cafesidoarjo latepost glutapancea glutafrozen kekinian olshopsurabaya olshopjakarta kuliner ayutingting surabaya

1 Minutes ago
TAS 75k ! cek ->  @threewshop (threew_shop) Instagram Photos and Videos

TAS 75k ! cek -> @threewshop

@threew_shop


Comment from TAS 75k ! cek -> @threewshop:


BUDAYAKAN MEMBACA SEBELUM ORDER GUYS 💋 JANGAN MALES BACA , SEBELUM ORDER DIPERHATIKAN DULU !!!!!!!!! 👌 BIASAKAN PILIH 1 ADMIN SAJA !!! ADA HARGA = RUPA 👇 *DIPERHATIKAN* KEMIRIPAN ? MODEL LUAR ? 80%-98% REAL PICTURE ? = 100% 👇 -UNTUK PEMESANAN- PRIVATE LINE : @sbe7001g (pake @) line : wahyu3tri BBM : D68178C5 👇 • PILIH SALAH SATU• //TIDAK BISA RETUR SIZE *APABILA SEPATU// 👉HARGA BELUM TERMASUK ONGKIR 👈 👇 HARGA 65.000 slingbagmurah sepatumurah sepatumurahbanget sepatubandung bandung hills hilsmurah hillsmurahbanget wedgesmurah wedges ootd onlineshop onlineshoptrusted slipon sliponhits slingbagmurah m2mbandung morymony tasmurah onlineshopmurahbanget

1 Minutes ago
free ongkir via app shopee (galeri_1406_new) Instagram Photos and Videos

free ongkir via app shopee

@galeri_1406_new


Comment from free ongkir via app shopee:


@60 . REPLIKA . KEMIRIPAN 80-90% . tas tasmurah jualtas taswanita tasselempang ootd ootdindo fashion fashionwanita gudangtas jualantas suppliertas reseller resellerwelcome freeongkir onlineshopbandung slingbag ransel

1 Minutes ago
SUPPLIER SEPATU TAS TERMURAH (_arumdume) Instagram Photos and Videos

SUPPLIER SEPATU TAS TERMURAH

@_arumdume


Comment from SUPPLIER SEPATU TAS TERMURAH:


Gs. Harga 85ribu (TAS REPLIKA) PENGIRIMAN DARI BANDUNG CARA PESAN/ ORDER ? 1. Hubungi salah satu kontak di bawah ini 👇👇👇 🔸Line : arumdume08 🔸BBM : 5CD744B1 🔸WA : 085693068887 ❎NO CALL / NO SMS❎ 2. Kirim gambar barang yang mau diorder / COPY URL FOTO / COMMENT DI FOTO 3. Isi format order - Nama penerima : - Alamat : (kec. + kota + prov.) - No.hp : - Orderan : . 🚫HARGA BELUM TERMASUK ONGKIR🚫 . grosirtasmurah jualtas taslokalmurah taslucu suppliertasmurah trustedseller trustedonlineshop tasmurah grosirtastermurah tascewek taskantor slingbagmurah taspesta tassekolah dompetlucu jammurah jamlucu jamcouple kadocewek paketantasmurah carireseller carikado kadolucu kadomama pakettasmurah taskualitassuper tasimportmurah taspunggung tasbackpack

1 Minutes ago
Grosir Fashion Import (myberrychic) Instagram Photos and Videos

Grosir Fashion Import

@myberrychic


Comment from Grosir Fashion Import:


IDR.159.000 Material : PU Leather Height : 20cm Length : 17cm Depth : 8cm Bag Mouth : Magnet + Zipper Long Strap : YES Weight : 450gram 1Sthandbag 1sthandimport tasmurah tasimport bagcollection bagimport bagkorea bagolshop bagshop belanjaonline belanjatasberkualitas bestseller branded brandedbag brandedbagmurahbrandedmurah brandedreplica carireseller cewek cewekcantik dagangan suppliertas tasbatam jualtasimport jualtasmurah tasimport tasimportmurah tasbangkok tasbkk

1 Minutes ago
SUPPLIER BAG'S (bag_fitta) Instagram Photos and Videos

SUPPLIER BAG'S

@bag_fitta


Comment from SUPPLIER BAG'S:


IDR : 75.000 Ket lengkap ada di foto ➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖ 🚚 Pengiriman tiap hari : 👉 Sabtu ➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖ 👜Katalog Baju @cloth_fitta 👠Katalog Sepatu @shoes_fitta ➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖ Fix Order Hubungi👇 👉BBM. : D4E8C6A8 👉LINE. : fittajensya onlineshopping fashionph hijab likeforlike likeforfollow like4follow trendfashion olshop bestpicture fff store tas tasmurah tasbandung grosirtasmurah

1 Minutes ago
KATALOG TAS & DOMPET (lsnbag.id) Instagram Photos and Videos

KATALOG TAS & DOMPET

@lsnbag.id


Comment from KATALOG TAS & DOMPET:


1 Minutes ago
dodol_tas (dodol_tas) Instagram Photos and Videos

dodol_tas

@dodol_tas


Comment from dodol_tas:


SALE SALE SALE kusus akhir bulan april aja ya. Kode : L Bahan : kulit sintetis Dalaman furing Harga : @47.000 Tunggu apa lagi kalo ada sale bagini 😀 buruan diborong tas murahnya. tasmurah tasmurahsurabaya slingbag slingbagmurah tascewek tascewekmurahtassurabayamurah tascewek tasmurah Mojokerto malanghits tasunik tasanak tasberanak tasmurah tasmurahsurabaya taswarna tascewek surabaya gresik sidoarjo mojokerto jombang pasuruan probolinggo nganjuk kediri kertosono jember malang papua kalimantan

1 Minutes ago
@grosir_kosmetik_indonesia (fruitaminsoap04) Instagram Photos and Videos

@grosir_kosmetik_indonesia

@fruitaminsoap04


Comment from @grosir_kosmetik_indonesia:


FRUITAMIN SOAP follow akun utama : @grosir_kosmetik_indonesia follow akun utama : @grosir_kosmetik_indonesia Hati2 SUDAH BEREDAR FRUITAMIN KW , PP nya fruitamin ori tapi saat dikirim ternyata KW size kecil ... Kami punya ORIGINAL , HARGA SESUAI KUALITAS YA ======================================== RUSAK TDK DPT KLAIM, SBLM KRM BRG KEADAAN SMUA BAIK Dijamin original 100% 10 bahan buah dalam 1 sabun Fruitamin soap terbuat dari campuran Gluta + Fruit + Vitamin. Ekstrak alami membantu menutrisi kulit dan gluta memutihkan kulit - Tomatoes : Lycopene, wajah pink merona - Orange: Vitamin C Concentrations, utk wajah segar - Kiwi : antioksidan kulit - Mulberry: penuh aneka vitamin dari berry - Banana: kulit halus lembut dan mengurangi radang - Grapes: kulit tetap kenyal - Pomegranate Ruby: anti oksidan dan memutihkan - Lemon: mengurangi jerawat - Tamarind : mengurangi bekas - Apple : menjaga kesegaran dan kesehatan kulit Ingredient coconut oil, rice bran oil, sunflower oil, glutathione, vitaminE, vitaminB3, vitaminC, perfume, apple extract, kiwi extract, tomato extract, pomegranate extract, lemon extract, orange extract, tamarind extract,, grape extract, mulberry extract, banana extract Fungsi: Memutihkan kulit 10x lebih efektif drpd sabun gluta lama karena kandungan lebih drpd 6 jenis sabun gluta Mengurangi bekas jerawat dan bekas luka Mengurangi peradangan dan jerawat memberikan efek kulit segar, merona, sehat melembabkan kulit dan mencerahkan kulit mengembalikan kulit gosong menjadi rata Ukuran 100 gr fruitamin fruitaminsoap fruitaminsoapmurah fruitaminmurah fruitaminori sabunfruitamin naturgo monomola sabunberas maskermata fairnpink pemutih cantik kecantikan pelangsing tas tasmurah tascantik tasbranded hijaber hijabers

1 Minutes ago
free ongkir via app shopee (galeri_1406_new) Instagram Photos and Videos

free ongkir via app shopee

@galeri_1406_new


Comment from free ongkir via app shopee:


@60 . REPLIKA . KEMIRIPAN 80-90% . tas tasmurah jualtas taswanita tasselempang ootd ootdindo fashion fashionwanita gudangtas jualantas suppliertas reseller resellerwelcome freeongkir onlineshopbandung slingbag ransel

1 Minutes ago
Grosir Fashion Import (myberrychic) Instagram Photos and Videos

Grosir Fashion Import

@myberrychic


Comment from Grosir Fashion Import:


IDR.159.000 Material : PU Leather Height : 20cm Length : 17cm Depth : 8cm Bag Mouth : Magnet + Zipper Long Strap : YES Weight : 450gram 1Sthandbag 1sthandimport tasmurah tasimport bagcollection bagimport bagkorea bagolshop bagshop belanjaonline belanjatasberkualitas bestseller branded brandedbag brandedbagmurahbrandedmurah brandedreplica carireseller cewek cewekcantik dagangan suppliertas tasbatam jualtasimport jualtasmurah tasimport tasimportmurah tasbangkok tasbkk

1 Minutes ago
FIRSTHAND IMPORT BAG SUPPLIER (ivi_outlet) Instagram Photos and Videos

FIRSTHAND IMPORT BAG SUPPLIER

@ivi_outlet


Comment from FIRSTHAND IMPORT BAG SUPPLIER:


READY STOCK Material : PU Leather Height : 20cm Length : 17cm Depth : 8cm Bag Mouth : Magnet + Zipper Long Strap : YES 450gram Color : black , brown , gray , red Handbagimport tasimport importbag importhandbag taskorea koreabag koreahandbag handbagfashion fashionbag fashionhandbag freeongkir gratisongkir ootd tasmurah fashionwanita ootdindo totebag tasbranded

1 Minutes ago
TAS 75k ! cek ->  @threewshop (threew_shop) Instagram Photos and Videos

TAS 75k ! cek -> @threewshop

@threew_shop


Comment from TAS 75k ! cek -> @threewshop:


BUDAYAKAN MEMBACA SEBELUM ORDER GUYS 💋 JANGAN MALES BACA , SEBELUM ORDER DIPERHATIKAN DULU !!!!!!!!! 👌 BIASAKAN PILIH 1 ADMIN SAJA !!! ADA HARGA = RUPA 👇 *DIPERHATIKAN* KEMIRIPAN ? MODEL LUAR ? 80%-98% REAL PICTURE ? = 100% 👇 -UNTUK PEMESANAN- PRIVATE LINE : @sbe7001g (pake @) line : wahyu3tri BBM : D68178C5 👇 • PILIH SALAH SATU• //TIDAK BISA RETUR SIZE *APABILA SEPATU// 👉HARGA BELUM TERMASUK ONGKIR 👈 👇 HARGA 65.000 slingbagmurah sepatumurah sepatumurahbanget sepatubandung bandung hills hilsmurah hillsmurahbanget wedgesmurah wedges ootd onlineshop onlineshoptrusted slipon sliponhits slingbagmurah m2mbandung morymony tasmurah onlineshopmurahbanget

1 Minutes ago
free ongkir via app shopee (galeri_1406_new) Instagram Photos and Videos

free ongkir via app shopee

@galeri_1406_new


Comment from free ongkir via app shopee:


@60 . REPLIKA . KEMIRIPAN 80-90% . tas tasmurah jualtas taswanita tasselempang ootd ootdindo fashion fashionwanita gudangtas jualantas suppliertas reseller resellerwelcome freeongkir onlineshopbandung slingbag ransel

1 Minutes ago
3R_Shop (diena_3rshop) Instagram Photos and Videos

3R_Shop

@diena_3rshop


Comment from 3R_Shop:


GIVENCHY KW Super Preimum Bahan Import 300.000 tasimport tasmurah handbag slingbag taspesta tas taskulit tasbaru import tasransel taskantor tasterbaru tasku tastas realpicture tasbagus tascantik tascewe fasion tasformal tasonline onlineshop trustonline tasKW taskwsuper kwsuper kwonline kwbagus kwpremium kwimport

1 Minutes ago
RCollectionSda_ (rcollectionsda_) Instagram Photos and Videos

RCollectionSda_

@rcollectionsda_


Comment from RCollectionSda_:


Idr : 85.000 RC136 bahan : katun Ukuran : allsize Line : @lov4663z bajumurah atasanmurah gratisongkir jammurah jamcouplemurah onlineshopsidoarjo trusted hijab pasmina segiempat instan blouse kemeja rajut tasmurah goviyar sidoarjoolshopmurah

1 Minutes ago
BATULICIN ONLINE SHOP (jamilahzent_shop1) Instagram Photos and Videos

BATULICIN ONLINE SHOP

@jamilahzent_shop1


Comment from BATULICIN ONLINE SHOP:


Harga : 130.000 Bahan : katun rayon motif songket MAU LIAT KOLEKSI WARNA/MODEL GESER KESAMPING YA..->-> HARGA SUDAH TERMASUK ONGKIR WILAYAH BATULICIN Minat bisa hubungi : - Bbm = D9903F29 - Line = Jamilah2103 - Sms = 082154874644 WELCOME RESELLER DAPAT POTONGAN HUBUNGI KONTAK DIBIO😊 KOMEN DIIG JARANG DIBALAS . . batulicin batulicinbungas batulicinshop jammurah jammurahbatulicin jambatulicin batulicinjomblo sungaidanau sungaidanaubungas kotabaru kalimantanselatan murahmeriah murahmurah indonesiamurah jualbaju jualtas jualan jualsepatu jualjam taskuliahmurah tasmurah sepatu slingbag totebag sepatumurah sepatukets bajuhijab bajumuslim sepatubatulicinmurah kebayakutubaru

1 Minutes ago
tas kualitas semi premium (mike_collection) Instagram Photos and Videos

tas kualitas semi premium

@mike_collection


Comment from tas kualitas semi premium:


Fashion single bag mini Series : A-02 harga satuan IDR 200.000 Size : 20 x 13 x 9 Material: kulit halus Berat Real 800gram Quality semipremi Colour : BLACK , GRAY ,PINK , PURPLE , PEACE , KHAKI tasbatam tasfashion tasbrandedreplika tasimpor tasmurah olshoptas pouch cluth coach handbag totebag ransel fashionbagmurah semipremium tascantik gudangtas taswanitamurah tasbatammurah

1 Minutes ago
free ongkir via app shopee (galeri_1406_new) Instagram Photos and Videos

free ongkir via app shopee

@galeri_1406_new


Comment from free ongkir via app shopee:


@60 . REPLIKA . KEMIRIPAN 80-90% . tas tasmurah jualtas taswanita tasselempang ootd ootdindo fashion fashionwanita gudangtas jualantas suppliertas reseller resellerwelcome freeongkir onlineshopbandung slingbag ransel

1 Minutes ago
Maradhia_Shop (maradhia_shop) Instagram Photos and Videos

Maradhia_Shop

@maradhia_shop


Comment from Maradhia_Shop:


💖ARIANA BONEKA bahan canvas jahitan rapi ukuran 23x27 tali bisa diatur good quality warna: biru, cream under 50k💋 tasmurah taskece tascewek taskekinian tasmurahsurabaya happyshopping maradhiashop

1 Minutes ago
ayutingting raffinagita joyagh (walletbagstuff) Instagram Photos and Videos

ayutingting raffinagita joyagh

@walletbagstuff


Comment from ayutingting raffinagita joyagh:


. 👉🏻 ORDER ? WAJIB KIRIM FORMAT LENGKAP YAH ! Kirim format lengkap nya yah kak sekali enter (jangan terpisah2) Biar bisa ditotalin dengan benar 😁👍🏻 Nama penerima : Alamat lengkap (kec+kab) : No hp : Nama brg + warna : . Jika dropship tulis nama pengirim nya ya . Diisi sekali enter kirim ke kita yah kak WA 085876518091 HARGA BELUM ONGKIR DR JAKARTA INFO ORDER CHAT READY & REALPICT ORDER ? KIRIM FORMAT LENGKAP NAMA : ALAMAT LNGKAP : NO HP : NAMA BARANG+WARNA: Line ke @KEB1129Q (pakai @) pembelian melalui line add get voucher 10rb untuk pembelian selanjutnya^^ suppliertastasjakartajakartaolshopreadystockrealpicthiqhqualitytasbrandedtasmurahtashitsolshopidsuppliertasbrandedtaskatespadetaschanneltashermeswalletbagstuffsyahriniincessbagmurmertasfurlatasfenditaspradatascelinetasgivenchytasimportjualanka grosirantaskonveksitascaritascaritasmurahtassyahrini.

1 Minutes ago
SUPPLIER SEPATU TAS TERMURAH (_arumdume) Instagram Photos and Videos

SUPPLIER SEPATU TAS TERMURAH

@_arumdume


Comment from SUPPLIER SEPATU TAS TERMURAH:


Gs. Harga 85ribu (TAS REPLIKA) PENGIRIMAN DARI BANDUNG CARA PESAN/ ORDER ? 1. Hubungi salah satu kontak di bawah ini 👇👇👇 🔸Line : arumdume08 🔸BBM : 5CD744B1 🔸WA : 085693068887 ❎NO CALL / NO SMS❎ 2. Kirim gambar barang yang mau diorder / COPY URL FOTO / COMMENT DI FOTO 3. Isi format order - Nama penerima : - Alamat : (kec. + kota + prov.) - No.hp : - Orderan : . 🚫HARGA BELUM TERMASUK ONGKIR🚫 . grosirtasmurah jualtas taslokalmurah taslucu suppliertasmurah trustedseller trustedonlineshop tasmurah grosirtastermurah tascewek taskantor slingbagmurah taspesta tassekolah dompetlucu jammurah jamlucu jamcouple kadocewek paketantasmurah carireseller carikado kadolucu kadomama pakettasmurah taskualitassuper tasimportmurah taspunggung tasbackpack

1 Minutes ago
TAS 75k ! cek ->  @threewshop (threew_shop) Instagram Photos and Videos

TAS 75k ! cek -> @threewshop

@threew_shop


Comment from TAS 75k ! cek -> @threewshop:


BUDAYAKAN MEMBACA SEBELUM ORDER GUYS 💋 JANGAN MALES BACA , SEBELUM ORDER DIPERHATIKAN DULU !!!!!!!!! 👌 BIASAKAN PILIH 1 ADMIN SAJA !!! ADA HARGA = RUPA 👇 *DIPERHATIKAN* KEMIRIPAN ? MODEL LUAR ? 80%-98% REAL PICTURE ? = 100% 👇 -UNTUK PEMESANAN- PRIVATE LINE : @sbe7001g (pake @) line : wahyu3tri BBM : D68178C5 👇 • PILIH SALAH SATU• //TIDAK BISA RETUR SIZE *APABILA SEPATU// 👉HARGA BELUM TERMASUK ONGKIR 👈 👇 HARGA 65.000 slingbagmurah sepatumurah sepatumurahbanget sepatubandung bandung hills hilsmurah hillsmurahbanget wedgesmurah wedges ootd onlineshop onlineshoptrusted slipon sliponhits slingbagmurah m2mbandung morymony tasmurah onlineshopmurahbanget

2 Minutes ago
YEOFashion.com (grosir_tas_murah.batam) Instagram Photos and Videos

YEOFashion.com

@grosir_tas_murah.batam


Comment from YEOFashion.com:


. FASHION TAS IMPORT BERKUALITAS - YEOFASHION.COM CODE PRODUK : 021807SN Green HARGA PROMO : Rp.181.000,00 Tinggi : 21 cm Lebar : 25 cm Tebal : 11 cm Tali Panjang : Ada Bahan : PU Berat : 700 g INFO PEMESANAN : BBM : 75D2876F WA : .0812 1062 4462 LINE ID : @pkh7616g *pakai Testi 👉 @testi_yeofashion http://yeofashion.com/21807SN-Green.html tasimport tasbatam tasmurah taswanita tasbranded tasdiskon taspromo tasfashion taskantor taspesta tasransel tascewek tascantik tasmumer tasterbaru tasbandung tasjakarta tasurabaya bajumurah bajuimport gratisongkir grosirtas grosirmurah grosirimport suppliertas resellertas sale olshopmurah yeofashion

2 Minutes ago
free ongkir via app shopee (galeri_1406_new) Instagram Photos and Videos

free ongkir via app shopee

@galeri_1406_new


Comment from free ongkir via app shopee:


@60 . REPLIKA . KEMIRIPAN 80-90% . tas tasmurah jualtas taswanita tasselempang ootd ootdindo fashion fashionwanita gudangtas jualantas suppliertas reseller resellerwelcome freeongkir onlineshopbandung slingbag ransel

2 Minutes ago
BATULICIN ONLINE SHOP (jamilahzent_shop1) Instagram Photos and Videos

BATULICIN ONLINE SHOP

@jamilahzent_shop1


Comment from BATULICIN ONLINE SHOP:


Harga : 100.000 Bahan jersey kombinasi bordir dilengan dan di dada + ada motr mutiara MAU LIAT KOLEKSI WARNA/MODEL GESER KESAMPING YA..->-> HARGA SUDAH TERMASUK ONGKIR WILAYAH BATULICIN Minat bisa hubungi : - Bbm = D9903F29 - Line = Jamilah2103 - Sms = 082154874644 WELCOME RESELLER DAPAT POTONGAN HUBUNGI KONTAK DIBIO😊 KOMEN DIIG JARANG DIBALAS . . batulicin batulicinbungas batulicinshop jammurah jammurahbatulicin jambatulicin batulicinjomblo sungaidanau sungaidanaubungas kotabaru kalimantanselatan murahmeriah murahmurah indonesiamurah jualbaju jualtas jualan jualsepatu jualjam taskuliahmurah tasmurah sepatu slingbag totebag sepatumurah sepatukets bajuhijab bajumuslim sepatubatulicinmurah kebayakutubaru

2 Minutes ago
TAS 75k ! cek ->  @threewshop (threew_shop) Instagram Photos and Videos

TAS 75k ! cek -> @threewshop

@threew_shop


Comment from TAS 75k ! cek -> @threewshop:


BUDAYAKAN MEMBACA SEBELUM ORDER GUYS 💋 JANGAN MALES BACA , SEBELUM ORDER DIPERHATIKAN DULU !!!!!!!!! 👌 BIASAKAN PILIH 1 ADMIN SAJA !!! ADA HARGA = RUPA 👇 *DIPERHATIKAN* KEMIRIPAN ? MODEL LUAR ? 80%-98% REAL PICTURE ? = 100% 👇 -UNTUK PEMESANAN- PRIVATE LINE : @sbe7001g (pake @) line : wahyu3tri BBM : D68178C5 👇 • PILIH SALAH SATU• //TIDAK BISA RETUR SIZE *APABILA SEPATU// 👉HARGA BELUM TERMASUK ONGKIR 👈 👇 HARGA 65.000 slingbagmurah sepatumurah sepatumurahbanget sepatubandung bandung hills hilsmurah hillsmurahbanget wedgesmurah wedges ootd onlineshop onlineshoptrusted slipon sliponhits slingbagmurah m2mbandung morymony tasmurah onlineshopmurahbanget

2 Minutes ago
TAS SEPATU IMPORT KOSMETIK dll (colorfullrs) Instagram Photos and Videos

TAS SEPATU IMPORT KOSMETIK dll

@colorfullrs


Comment from TAS SEPATU IMPORT KOSMETIK dll:


Bismillahirahmanirahim ✔Tas Lokal✔ 💰PRICE : serba 70.000 📝 Format Order : Nama : Alamat : No. HP: Orderan: COD (Khusus area Semarang ) : 1. Pom Bensin Ramai( Suratmo, Semarang Barat) 2. Museum Ronggowarsito (Semarang Barat) kirim ke salah satu kontak(lihat Bio) 🙅jangan double order ke semua kontak ☝chat sesuai format kami dahulukan Thanks Happy Shopping dear ❤ jualonlineonlineshopsemarangonlinetasonlinesepatuonlinedompetdompetmurahtasmurahsepatumurahsandalmurahsepatusandalbagshopshoeswalletolshopsemarangsemarangjogjasolojeparajakartabandungtasmurahsemarangsepatumurahsemarangsemaranghitstokoonlinemurahonlineonlineshop

2 Minutes ago
3R_Shop (diena_3rshop) Instagram Photos and Videos

3R_Shop

@diena_3rshop


Comment from 3R_Shop:


GIVENCHY KW Super Preimum Bahan Import 300.000 tasimport tasmurah handbag slingbag taspesta tas taskulit tasbaru import tasransel taskantor tasterbaru tasku tastas realpicture tasbagus tascantik tascewe fasion tasformal tasonline onlineshop trustonline tasKW taskwsuper kwsuper kwonline kwbagus kwpremium kwimport

4 Minutes ago
Syahrini (ts_bagshop) Instagram Photos and Videos

Syahrini

@ts_bagshop


Comment from Syahrini:


Readystock GUEES Gs176 Pink Sig idr 545.000 (25×22×12cm ) Free Dustbag + Paperbag guess Order line: @ntf8140z or Tsbagshop Wa: 08973864626 Bbm: 763EF2DF tascnkasliaszaraorijualtascnkoriginaljualttascnkmurahtascnkjualtasoritasorimurahtasmangomurahtasmangoaslitasmangoorijualtaszarajualtasmangotasguessmurahtasguessorijualtasguessdompetguessdompetcewektasbrandedmurahtasimporttasmurah

5 Minutes ago