Search Tagsfor trying

Salim (salemtours) Instagram Photos and Videos

Salim

@salemtours


Comment from Salim:


makeup makeupartist trying makeuptutorial selfie myself dinner lifestyle ootd instagood instagramers blog blogger parisian lifestyleblogger instamoment instamood smile architecture

1 Minutes ago
Heyyy Guys!! (justmyrandomshit) Instagram Photos and Videos

Heyyy Guys!!

@justmyrandomshit


Comment from Heyyy Guys!!:


So yesss this is my first post and I think I'm going to make this page a little bit like a diary... Today was school and yes I got really stressed again... That's why I want out for a bit.. nature always helps me😁✌ • ° • ° nature freedom me memyselfandI alone stressed page newpage Hashtag jeans flowers stressedout calm trying going leaf

1 Minutes ago
Simon (simon7513) Instagram Photos and Videos

Simon

@simon7513


Comment from Simon:


Night time jogging.. amuturephotographer trying nighttimedogwalk blackandwhitephotography lonlyrunner

2 Minutes ago
Crystal🔮 (_crystal.ball) Instagram Photos and Videos

Crystal🔮

@_crystal.ball


Comment from Crystal🔮:


It feels really good to know that after only 2 runs in the last few weeks that I can accomplish this! I know it's not much, but it's something to me!! Wooo 3.3km jog/walk in 28 mins? I'll take it! proud running runner trying

5 Minutes ago
Sarah (sarahjanek1214) Instagram Photos and Videos

Sarah

@sarahjanek1214


Comment from Sarah:


Walk/run with Toby ❤☀ it's so beautiful out! walkingmydog walk run sunglasses shorts yorkie yorkshireterrier sunny beautifulday proud trying warm

5 Minutes ago
Simon (simon7513) Instagram Photos and Videos

Simon

@simon7513


Comment from Simon:


The lights are all a blur.. nighttimedogwalk blurylights amuturephotographer trying

5 Minutes ago
 (whutwhalefml) Instagram Photos and Videos

whutwhalefml

@whutwhalefml


Comment from whutwhalefml:


OMG ME WHY IS THIS ME

7 Minutes ago
Tom Evans (thisistomevans) Instagram Photos and Videos

Tom Evans

@thisistomevans


Comment from Tom Evans:


• ~ fall's remnants lay bare. ~ winter concealed; spring exposed. ~ an acorn sprouts! Push! ••••••••••••••••••••••••••••••••••••••••••• Haiku & photo from my lunchtime walk today.

7 Minutes ago
Elif Karataş (_.eliff_) Instagram Photos and Videos

Elif Karataş

@_.eliff_


Comment from Elif Karataş:


everything is gonna be alright all it takes is some trying life is crazy sometimes just holdon senorita instadaily afternoonwalk take deep breath peaceful place 😎 😇 💞 👣

9 Minutes ago
Angélique Stempelkeuken (stempelkeuken) Instagram Photos and Videos

Angélique Stempelkeuken

@stempelkeuken


Comment from Angélique Stempelkeuken:


Just keep trying 🙂 . . stempelkeuken stampinup stampinupnl quote quoteoftheday creatief create creative creativity creativityfound denhaag thehague zuidholland westland handmade handlettering blackwhite blackandwhite zwartwit instaquote trying handletteren

12 Minutes ago
Silke De Bruyn (bruyntje98) Instagram Photos and Videos

Silke De Bruyn

@bruyntje98


Comment from Silke De Bruyn:


Every day one step closer, without any fitness. Yes I'm a little bit proud of myself... like4like blonde 19y yeswecan yeswewill justbecause Icandoit blondhair music proud livelaughlove positivevibes muscles😂 everydayastepcloser closer finishline selfieeeee BW blackandwhite justme trying living happier belgian dontmesswithme nochance quote

16 Minutes ago
FUNNY BANTER PAGE (banterproduction) Instagram Photos and Videos

FUNNY BANTER PAGE

@banterproduction


Comment from FUNNY BANTER PAGE:


WHO ELSE IS TRYING TO SAVE THEIR GRADES NOW 😭😭😭😭😭😭 . . . . . . . . . . . bruh she did cpr revive on pigeon bird nature funnyvideo jokes 😂 nahh me trying to revive my grades school highschool secondaryschool university college secondary lool viral nah hahaha

17 Minutes ago
Κατερίνα Τσιλιγγερίδη (katiatsil21) Instagram Photos and Videos

Κατερίνα Τσιλιγγερίδη

@katiatsil21


Comment from Κατερίνα Τσιλιγγερίδη:


Όταν επιμένει να δοκιμάσει σοκολατάκι με λικέρ 😂 mydaughter trying chocolateamaretto

19 Minutes ago
StyleMore🦋 by (lommyleweni) Instagram Photos and Videos

StyleMore🦋 by

@lommyleweni


Comment from StyleMore🦋 by:


Getting back to it slowly after 2 weeks leave. fijiboy gaydude fijilgbt fijiansintheuk surrey unfit trying 😜🌺

20 Minutes ago
Marco Torres (marcostorres2910) Instagram Photos and Videos

Marco Torres

@marcostorres2910


Comment from Marco Torres:


Please? I Am Trying

22 Minutes ago
Saorise Butler-Smith (seisha18) Instagram Photos and Videos

Saorise Butler-Smith

@seisha18


Comment from Saorise Butler-Smith:


This QMC sign is trying to hold itself up just as much as me rn ⭐️⭐️ • {collegeexamstryinghelpmekindadyingfailsmernhelp}

26 Minutes ago
Sarah Chaffey (sarahchaffeyy) Instagram Photos and Videos

Sarah Chaffey

@sarahchaffeyy


Comment from Sarah Chaffey:


彼氏のためにお弁当を作った☺️💕 obento bentobox lunch love tamagoyaki lunchbox お弁当 japanesefood hehe atleastitried bento trying food lunchtime foodstagram japanese egg hungry rice たまごやき ご飯 🍱

27 Minutes ago
Gregor Bowl (gregor_bowlz) Instagram Photos and Videos

Gregor Bowl

@gregor_bowlz


Comment from Gregor Bowl:


You will constantly be confronted with obstacles, it never gets "easier" you just get BETTER at dealing with things. So, be grateful for the hard times just as much as the easy times..challenges build character. aesthetics gym fitntess fitfam hat kg greek needpizza old pic mcfit proud blessed trying chestday veins

27 Minutes ago
Lisa Rahm (rahmsossi) Instagram Photos and Videos

Lisa Rahm

@rahmsossi


Comment from Lisa Rahm:


portrait selfie trying snapchat funny ilike brownhair home freckles

28 Minutes ago
Harrietttt 🌸 (hazzachazza92) Instagram Photos and Videos

Harrietttt 🌸

@hazzachazza92


Comment from Harrietttt 🌸:


Monday Message ✌🏼🙋🏼 monday message quote positive positivity trying challenging work job career yearsix sats life true accurate myself me girl love potd qotd

32 Minutes ago
nadiasalur (nadiasalur) Instagram Photos and Videos

nadiasalur

@nadiasalur


Comment from nadiasalur:


yoga practice anytime anywhere ✨ trying out my new naturaljute yogamat 👌 loveit 💜💜💜 feels like a grass carpet🍀 doesn't slide 👍 check it out jutemat @nadiasalur iinhealthcoach

32 Minutes ago
Elizabeth Simon (ejmsimon15) Instagram Photos and Videos

Elizabeth Simon

@ejmsimon15


Comment from Elizabeth Simon:


trying new things

32 Minutes ago
gh_chenzhen (nightingale_chen06) Instagram Photos and Videos

gh_chenzhen

@nightingale_chen06


Comment from gh_chenzhen:


Literally done.💔 simplyme happyme me myself bulletproof simplicitystronger livelife lovelife enjoylife live betrayeddone trying wildandfree happiness contentment peacofmindpeace lovehatecarryonlolemo doha crazinessqtr insta instagood instalikes

33 Minutes ago
Daria Dudziak (dudziakdaria) Instagram Photos and Videos

Daria Dudziak

@dudziakdaria


Comment from Daria Dudziak:


Spanish orange almond cake who knew gluten, wheat,dairy free bakes can taste so yummymy bakingtrying new recipesexploring new flavours

34 Minutes ago
kaf_ye_alef_noon (kaf_ye_alef_noon) Instagram Photos and Videos

kaf_ye_alef_noon

@kaf_ye_alef_noon


Comment from kaf_ye_alef_noon:


mobilymonsterskeeptryingfortheirlife

35 Minutes ago
👊•STRUGGLE FOR PLEASURE•👊 (man_deserves_happiness_in_life) Instagram Photos and Videos

👊•STRUGGLE FOR PLEASURE•👊

@man_deserves_happiness_in_life


Comment from 👊•STRUGGLE FOR PLEASURE•👊:


struggleforpleasure tell dream show success struggle dreams stepbystep behappy power trying life betterlife focus buildingthenew proof trying tryhard mademistakes dailyinspiration success motivation inspiration personaldevelopment selfdevelopment selfmade behappy beyourself feelgood openmind greatworld struggle justdoit tryhard nevergiveup

36 Minutes ago
Claire Finn (finnclaire) Instagram Photos and Videos

Claire Finn

@finnclaire


Comment from Claire Finn:


bodypaint mua nature weather lightning model galexy space smallbackdropfail trying

37 Minutes ago
Jodie (jodieraeturner) Instagram Photos and Videos

Jodie

@jodieraeturner


Comment from Jodie:


🤙🤙holiday 🌞🌞🌊🌊 belly trying effort holiday fucksake fishnets exercise weight noready help 1weektogo chub curvy chubby lol fml

38 Minutes ago
Veronica Elizabeth (sparklessmagee) Instagram Photos and Videos

Veronica Elizabeth

@sparklessmagee


Comment from Veronica Elizabeth:


A little bit better every day. practicemakesperfect trying

38 Minutes ago
Sharon Chung (songsofsharon) Instagram Photos and Videos

Sharon Chung

@songsofsharon


Comment from Sharon Chung:


Me on the ferris wheel looking very happy but trying not to throw up me trying to stop him from spinning the bloody thing ferriswheel germany hkig

39 Minutes ago
@fer.draw.ing (fer.draw.ing) Instagram Photos and Videos

@fer.draw.ing

@fer.draw.ing


Comment from @fer.draw.ing:


🙋🏻‍♂️🙋🏻‍♂️🙋🏻‍♂️🙋🏻‍♂️ boatarde firstman femaleartist seguidor trying hobby art draw adobedraw man realisticdrawing desenhorealista beginner autodidata details rabisco processo inicio

39 Minutes ago
James Ford Nails (jamesfordnails) Instagram Photos and Videos

James Ford Nails

@jamesfordnails


Comment from James Ford Nails:


gym gym💪 gymdo gymrat gymtime gymlife gymshark pursuefitness summerbody training workout trying armworkout biceps bicepworkout protein proteinshake huddersfield jamesfordnails

41 Minutes ago
HATCH (hatchgal) Instagram Photos and Videos

HATCH

@hatchgal


Comment from HATCH:


Tag a friend who's on our timetable. 🕑 monday trying momisms

42 Minutes ago