Search Tagsfor vegetables

HR_photography (hr_photographie) Instagram Photos and Videos

HR_photography

@hr_photographie


Comment from HR_photography:


Vegetables ? No one care. photographie photography photographer streetphotography color souk vegetables morrocanvibes casablancavibes casablanca morocco picoftheday instadaily instalike followme likeme

48 Seconds ago
Denise Rutherford Kelly (bossladyexec) Instagram Photos and Videos

Denise Rutherford Kelly

@bossladyexec


Comment from Denise Rutherford Kelly:


Better Eating, Better Health, Better Wealth, Better Life. I'm Sure there's Something You Can Be Better At. It's Better when we do it TOGETHER! Come on and go with us. Join the "BETTER" movement... Here's a little something to help you Eat Better...Pineapple Salsa... cheflife chefnplanner diabetes diet salsa recipe recipevideo howto cooking cool amazing food foodie foodporn foodpics foodgram cheflife chefsofinstagram instagood instafood instagram eattolive diabetes type type2 fitness vegan fruits vegetables vegetarian

49 Seconds ago
Dante Gibson (dantegibson) Instagram Photos and Videos

Dante Gibson

@dantegibson


Comment from Dante Gibson:


Carne Asada Fries, Sub Fries for Taco Seasoned Green Beans, Fresh Guac, Jalepenos, Queso👌🏾▪️ChefDG Truecooks ▪️cheflife chefslife ◾️ ◾️ ◾️ ◾️ ◾️ FoodPorn fitlife Foodie cheese спорт comida питание cena 👨🏾‍🍳 abendessen jantar зож غذا vegetables лето солнце фитнес ディナー 晚餐 공식만찬 شام FoodAF mcfit arizona carneasada mexicanfood

54 Seconds ago
 (mypescatariandiary) Instagram Photos and Videos

mypescatariandiary

@mypescatariandiary


Comment from mypescatariandiary:


My dinner was homemade vegan haggis which is red lentils, carrots, onions, mushrooms, kidney beans, vegetable stock and oatmeal with some mashed carrots and mashed potatoes with vegan butter😊 haggisveggiehaggisvegetarianhaggisveggiehaggisvegetablesredlentilscarrotsonionsmushroomskidneybeansoatmealvegetablestockmashedpotatoesmashedcarrotsveganbutterveganfoodvegetarianfoodpescatarianfooddinner

1 Minutes ago
Steph (pancake_fitness_addict) Instagram Photos and Videos

Steph

@pancake_fitness_addict


Comment from Steph:


Frühstück auf der Arbeit heute: grüner Smoothie von @aldisuedde ❤ echt lecker, und pro Flasche (250g) nur 110kcal 😍😊 schlaft gut 😘 smoothie greensmoothie aldi vegetables Fruit love pizzalover pasta italia foodgasm shape inshape curves discipline dedication gesundabnehmen abnehmen downsizing getfit fitfam fitspo Diät diet Protein gesund gainz gains abspecken foodporn

1 Minutes ago
Micaela Pagliari (miclik_) Instagram Photos and Videos

Micaela Pagliari

@miclik_


Comment from Micaela Pagliari:


pizza pizzalover family dinner dinnertime vegetables vegetarian instagood montegranaro patrizia foodblogger foodporn food bestpizza

2 Minutes ago
 (amandas.lean.dream) Instagram Photos and Videos

amandas.lean.dream

@amandas.lean.dream


Comment from amandas.lean.dream:


fish tonight! seabass with carrots and broccoli following tonight's workout. Tried my barbell for the first time to help with my squats. There's a bony bit at the top of my spine which really hurts if the barbell touches it. The pad really helped. weightlossjourney fitnessjourney fatlossjourney weightlossgoals healthyfood healthyeating eatinghealthy fishy vegetables pescatarian slimmingworlduk slimmingworld

2 Minutes ago
GreenShootsFoundation (greenshootsfoundation) Instagram Photos and Videos

GreenShootsFoundation

@greenshootsfoundation


Comment from GreenShootsFoundation:


2 Minutes ago
 (pinkaholicsheep) Instagram Photos and Videos

pinkaholicsheep

@pinkaholicsheep


Comment from pinkaholicsheep:


. . . guineapigguineapigspandafattyanimalssmallanimalcavyguineapigsofinstagrampetpetstagrambabypiggyhamstervegetarianinstapiganimalsguineapigsof_igwebstapickvegetablesguineapigposts101guineapiglovehandsomepetadorblehurgryfluffysleepingbabyinstapicphotoshoot豚鼠hotspotguineapigsofinsta

2 Minutes ago
fitness & food (nataliefitnessuk) Instagram Photos and Videos

fitness & food

@nataliefitnessuk


Comment from fitness & food:


Lightly dusted lemon sole and veggies tonight before leg day begins! dinner fish lemon vegetables food igfood fitness gym workout body slim diet lean lifestyle follow like

2 Minutes ago
 (extremegrill) Instagram Photos and Videos

extremegrill

@extremegrill


Comment from extremegrill:


Sallatë shope, për një darkë të lehtë.. Shijshëm dhe shëndetshëm! extreme grill healthy food vegetables cheese salad tasty yummy diet

3 Minutes ago
Sara Carvalho (changeyourbodybysc) Instagram Photos and Videos

Sara Carvalho

@changeyourbodybysc


Comment from Sara Carvalho:


Janta vegetariana! É tudo maravilhoso!! changeyourbodybysc 3porsemana eusouwh fitnessaddict fit fitgirls fitness fitworld goodfood veggie protein vegetables eggs eggslovers healthy healthyl morning posworkout postreino noexcuses eatclean motivation gym sagafitpt foconadieta gymlovers alimentacaosaudavel reeducaçãoalimentar

3 Minutes ago
Styled Ramblings (styledramblings) Instagram Photos and Videos

Styled Ramblings

@styledramblings


Comment from Styled Ramblings:


Butternut and spinach pasta with sage beurre noisette and blue cheese. Styling by @meanda17 icachef feedfeed pasta glutenfree chef cheflife chefstudent students vegetarian treat vegetables foodstagram foodphotography food foodstyling healthy lunch goodlife dinner green buzzfeedfood hand instafood instagood pretty

3 Minutes ago
besonderS*S (besonders_s) Instagram Photos and Videos

besonderS*S

@besonders_s


Comment from besonderS*S:


So soll Pasta sein 💚... genossen bei @j.lingenhel 💚... einfach besonderS 💚 foodporn foodblogger foodstagram veggie healthyfood green vegetables parmesan italian barilotto erbse petersilie besonders besonders_s

3 Minutes ago
Maria (maria_at_unleashlifetoday) Instagram Photos and Videos

Maria

@maria_at_unleashlifetoday


Comment from Maria:


Repost @unleashlifetoday with @repostapp ・・・ A Pineapple a day keeps the worries away! thirstythursday delicious tasty fresh clean healing wellbeing wellness nourish nutrition healthy raw organic vegan pineapple recovery workout healthyliving healthybody healthyeating unleash life coldpressed juice fortlauderdale miami herbs fruit vegetables

3 Minutes ago
Linsan (_veganchick_) Instagram Photos and Videos

Linsan

@_veganchick_


Comment from Linsan:


Smoothie bowl for dinner tonight 🙌🏻 so filling yet light and delicious 😛 banana, mango, strawberries, mixed seeds, hemp seeds, corn flakes and flaxseeds 😋cleaneatingveganveganfoodshareveganfoodveggiesvegetablesveganlifenooilvegansofinstagramvegangirlveganchickveganlifestylevegveganpowerhealthyhealthplantpoweredplantsplantlifecrueltyfreecrueltyfreelifestylecrueltyfreefoodcrueltyfreelifecrueltyfreelivingcrueltyfreeeatinggoodfoodgoodfoodgoodlifeplantpower

3 Minutes ago
Elizabeth Pattalis (blissfulbeautifulplantlife) Instagram Photos and Videos

Elizabeth Pattalis

@blissfulbeautifulplantlife


Comment from Elizabeth Pattalis:


Broccoli mung bean pasta. I love having broccoli like this. Steam or boil the broccoli and then blend it up with a little olive oil, lemon juice, chilli, nutritional yeast and season with salt and pepper. So easy. comfortfood

3 Minutes ago
A N N A | 1 9 (veggiefication) Instagram Photos and Videos

A N N A | 1 9

@veggiefication


Comment from A N N A | 1 9:


Pizza 😍😍😍 vegetarian vegetarisch healthy healthyfood eathealthy eatclean cleaneating cleanfood instafood delicious yummy photography foodblogger photographie vegetables culinary cooking active fitness foodlover dinner pizza fastfood italian cheesy meatless

4 Minutes ago
Bene (bene_mangia_sano) Instagram Photos and Videos

Bene

@bene_mangia_sano


Comment from Bene:


Questa sera, nonostante la mia ora in palestra sul tapis roulant a bruciare un bel pó di calorie 🏃🏽‍♀️, non ho fame per niente! Sarà il super pranzo di oggi, che ancora sto facendo difficoltà a digerire 😪.. quindi ho optato per un'insalata con pezzetti di coscio di pollo bolliti, il tutto condito con olio di oliva e aceto balsamico 🥗. dinnerdinnertimelatergramlatedinnerhealthylifehealthydinnerhealthyeatingpostworkoutmangiaresanowellnesssalutebenesserevegetableschickenoillightlightdinnerdietitiandietafitnessfitnessgirlfitnessfood

4 Minutes ago
La Cuisine De Letty (lacuisinedeletty) Instagram Photos and Videos

La Cuisine De Letty

@lacuisinedeletty


Comment from La Cuisine De Letty:


Cauliflower crust vegetarian pizza cauliflower pizza vegetables vegetarian veggies food foodie foodlover foodporn picoftheday instagood instafood foodstagram manger essen mangiare lecker delicious healthy fit healthyfood fitfood

4 Minutes ago
Marine Mandarine (berlin_marine_mandarine) Instagram Photos and Videos

Marine Mandarine

@berlin_marine_mandarine


Comment from Marine Mandarine:


Spinachlove. raw spinach peanut tahini tamari vegan recipes hclfvegan vegetables sidedish easy tasty mandarine marine

4 Minutes ago
gratitude yoga chicago (gratitudeyogachicago) Instagram Photos and Videos

gratitude yoga chicago

@gratitudeyogachicago


Comment from gratitude yoga chicago:


Taste the Rainbow 🌈 May we always be grateful for the fruits, veggies, animals, plants, nature we consume daily. Be grateful for the process of planting and growing. Be grateful for the humans who help deliver the food. Be grateful for the grocers. Be grateful for the art of cooking. Then of course be grateful for the best part, the eating. What color of the rainbow are you tasting today?

4 Minutes ago
Vi Vi (vi_v_i_i) Instagram Photos and Videos

Vi Vi

@vi_v_i_i


Comment from Vi Vi:


Velouté carottes - courge - persil ☺ J'adore sa couleur ! diner dinnertime🍴 dinner🍴 soupe soup healthy healthyfood vegetables vegetarians vegetarianfood vegetarienne eatyourgreens smoothness greedy carrot heresmyfood homemadefood enjoy lovefood eatclean cleaneating glutenfreefood onmytable

4 Minutes ago
Healthquestlife (healthquestlife) Instagram Photos and Videos

Healthquestlife

@healthquestlife


Comment from Healthquestlife:


Ready to be roasted! vegetables organic plants greens healing guthealth digestion nutrition nutritionist coaching motivation healthy healthyfood healthybacteria diabetes grainfree dairyfree wholefoods canada vancouver coquitlam montreal localfood humanfood diet foodthatheals antiaging antioxidants

4 Minutes ago
Matthew Zavell (madmattz) Instagram Photos and Videos

Matthew Zavell

@madmattz


Comment from Matthew Zavell:


Most salad dressings are filled with garbage🔝 That's why I stopped using them,  oppting for fresh squeezed lemon juice instead. But, that got boring😑 So, I started making my on dressing. My current favorite is a honey mustard vinagerrete. Total prep time is barely 2 minutes. Use approximately 1/2tbs grape seed oil, 1 1/2tbs fresh lemon juice, 1tsp organic honey mustard, a cap full of apple cider vinegar, garlic powder, fresh ground pepper and a dash of Himalayan pink salt. recipe yields enough for one large salad. enjoy recipe salad vegetables organic healthy fitness diet nutrition health dressing spices lemon mustard applecidervinegar gmo monsanto soutflorida

4 Minutes ago
Natalia (fitness_nataliaa) Instagram Photos and Videos

Natalia

@fitness_nataliaa


Comment from Natalia:


CENA SUPER- FIT 💞 ( por cierto me acabo de dar cuenta de que se me ha acabo la avena... 😭😭) Lechuguita ➕ casi 200g de queso cottage NO LIGHT (Alguien se me adelanta y no quedan mas que uno o dos para cuando voy a lidl 👊👊)➕ lata de atun ➕ Tomatiitos Cherry ➕ Pepinillo ➕ Especiias. vegetables healthyliving like eatclean fit fitness fitsgram perfectnever vegetarian fitnessfoodfitnessgirl fitfrenchies vegan training gymfreak fitforlife fitnessinspiration fitlife justhealth coffeefitfam healthylifestyle fitnessadicction bodymotivation fitnesslive gymrat fitnessmotivation

4 Minutes ago
Kristen Ortega (kristen0rtega) Instagram Photos and Videos

Kristen Ortega

@kristen0rtega


Comment from Kristen Ortega:


Potting and planting our veggies on this fine day planting Gardening learning exposure purple pots potting veggies vegetables spring organic fresh homegrown homestead natural toddler experience soil dirty harvest reap sow seeds growth water care lifelesson

4 Minutes ago
 (inspirezen) Instagram Photos and Videos

inspirezen

@inspirezen


Comment from inspirezen:


vegetables

4 Minutes ago
Helena Davis~Gut Health Expert (helenadavis_guthealthexpert) Instagram Photos and Videos

Helena Davis~Gut Health Expert

@helenadavis_guthealthexpert


Comment from Helena Davis~Gut Health Expert:


Fresh delicious parsley from our garden. We love growing our own herbs and veggies 😀 Parsley is high in vitamin C, magnesium and is fabulous for your kidneys. Enjoy Vital Ones 😘

4 Minutes ago
Alex (conmomphotography) Instagram Photos and Videos

Alex

@conmomphotography


Comment from Alex:


I posted my AN sign up last night and I'm already booked ;-; I can't believe it! I am going to work it out to open more slots later!! 🤓💕_______________________________________________________ @vongolaprima asked me to rebrand her old photos from AN last year, so thought to post one!! 🍅

6 Minutes ago
COME VIVE ADELGAZA (comeviveadelgaza) Instagram Photos and Videos

COME VIVE ADELGAZA

@comeviveadelgaza


Comment from COME VIVE ADELGAZA:


Hoy no he ido al gimansio. Después de la clase de ayer me duele todo 😓😓😓. Pero hay que volver a coger el hábito. . . Ya se que os dije que hoy para cenar haría hummus. Pero esta tarde he visto la ensalada de @gu_nutricion que llevaba remolacha y se me ha antojado muchísimo. Y no, no estoy embarazada 😎. . . CENA: Crema de remolacha con queso crema batido desnatado 0% con semillas y aove. Gelatina de limón 0%. Agua. Receta superfácil si os gusta la remolacha. Y sinó con cualquier otra verdura. Las cremas es lo que tienen que para gustos colores. Yo a ésta le he puesto chía, almendras, pistacho y pipas de girasol, pero podéis ponerle las semillas que querais. Ahora me pongo a ver vuestros platos. Que vaya nivel que hay por aquí. Buenas noches, y ánimo campeon @s. Que no decaiga !!! 💪💪💪😘😘😘 . . . remolacha crema cremadeverdura beet vegetable

7 Minutes ago
Pip McKay (rawfire_life) Instagram Photos and Videos

Pip McKay

@rawfire_life


Comment from Pip McKay:


Year in a couple months has gone past since I started the asparagus bed. When your first establishing asparagus and you can't pick it the first year. So I have blindly been waiting for a full year to see what will come up in the garden. One asparagus at the end of March is a good sign. If I can just get enough to feed the family for a Meal or two I will consider ProjectAsparagus A Success!

9 Minutes ago
The Two Buckets (thetwobuckets) Instagram Photos and Videos

The Two Buckets

@thetwobuckets


Comment from The Two Buckets:


Blending up a morning smoothie is a great way to check off those nutrients we all need every day. Today blog post features some tips on how to make it manageable for an everyday breakfast. . . . health healthlifestyle thetwobuckets blog tips habits apple banana beetroot berries blenders cacaopowder flax chia fruit ginger green healthy kale lemons limes macapowder oats peanutbutter plant-based smoothies turmeric vegan vegetables vitamins

2 Hours ago